SecReT6
Protein ID: 482902451
SecReT6 ID756
T6SS typei4a
Gene symbol-
Locus tagAvCA6_50810
StrainAzotobacter vinelandii CA6
Repliconchromosome [GenBank: NC_021150] [Browse all T6SS(s) in this replicon]
Location [Strand]5107749..5109230 [+]
ProductDUF877 family protein
NoteTssC
UniProt IDM9YT15
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.90E-187, Aligned region: 66..488
Protein Sequence: 493 a.a.     [Download]
>gi|482902451|ref|YP_007900958.1| DUF877 family protein [Azotobacter vinelandii CA6]
MAQPSAGETQASENITLSLLDRIIAEGRMAHDDSQQDYARDMLAEFATQVLDEGMAIDKDTVSMINDRIA
QIDALIGAQLDEILHHPELQKLEASWRGLHMLVKNTETGARLKLRLLNVTQKELLIDLEKAVEFDQSALF
KKIYEEEYGTFGGHPFSLLVGDYSFGRHPQDIGLLEKLSNVAAAAHAPFIAAASPRLFDMGSFTELAVPR
DLAKIFESQELIKWRAFRESEDSRYVSLVLPHVLLRLPYGPDTCPVEGMDYVEDVNGRDHARYLWGNAAW
ALTQRITEAFARYGWCAAIRGVEGGGAVEGLPAHSFRTSSGDLSLKCPTEVAITDRREKELDALGFIALC
HKKNSDLAVFFGSQTTNRPRVYNTNEANANARISAMLPYVLAASRFAHYLKVIMRDKVGSFMTRDNVQTY
LNNWIADYVLINDNAPQEIKAQYPLREARVDVSEVVGKPGVYRATVFLRPHFQLEELTASIRLVATLPPP
AAA
 
Nucleotide Sequence: 1482 bp     [Download]
>gi|482897536|ref|NC_021150.1|:5107749-5109230 Azotobacter vinelandii CA6, complete genome
ATGGCCCAGCCGTCCGCCGGCGAGACCCAAGCCAGCGAGAACATCACCCTGTCCCTGCTCGACCGCATCA
TCGCCGAGGGCCGCATGGCCCACGACGACAGCCAGCAGGACTACGCCCGCGACATGCTCGCGGAGTTCGC
CACCCAGGTCCTCGACGAAGGCATGGCCATCGACAAGGACACCGTGTCGATGATCAACGACCGCATCGCC
CAGATCGATGCGCTGATCGGCGCCCAGCTCGACGAAATCCTCCACCATCCCGAGTTGCAGAAGCTGGAAG
CCTCCTGGCGCGGCCTGCACATGCTGGTGAAGAACACCGAGACCGGCGCGCGTCTGAAGCTGCGCCTGCT
CAACGTGACCCAGAAGGAACTGCTGATCGATCTGGAGAAGGCCGTCGAGTTCGACCAGAGCGCGCTGTTC
AAGAAGATCTACGAGGAAGAGTACGGCACCTTCGGCGGGCATCCGTTCAGCCTGCTGGTCGGCGACTACA
GCTTCGGCCGCCATCCGCAGGACATCGGCCTGCTGGAAAAGCTCTCCAACGTCGCCGCCGCCGCCCATGC
GCCCTTCATCGCCGCGGCCAGCCCGCGCCTGTTCGACATGGGCAGTTTCACCGAACTGGCGGTGCCGCGC
GATCTGGCGAAGATCTTCGAGAGCCAGGAACTGATCAAGTGGCGCGCCTTCCGCGAGAGCGAGGATTCGC
GCTACGTCTCCCTGGTGCTGCCGCACGTCCTCCTGCGCCTGCCCTACGGACCGGACACCTGCCCGGTGGA
AGGCATGGACTACGTCGAGGATGTCAACGGCCGCGACCACGCCAGGTACCTCTGGGGCAATGCCGCCTGG
GCCCTGACCCAGCGCATCACCGAGGCCTTCGCCCGCTATGGCTGGTGCGCGGCGATTCGCGGCGTGGAAG
GCGGCGGCGCGGTCGAGGGCCTGCCGGCGCACAGCTTCCGCACCAGCTCCGGCGACCTGTCGCTGAAATG
CCCGACCGAGGTGGCGATCACCGACCGTCGCGAAAAGGAACTCGACGCACTCGGCTTCATCGCCCTCTGC
CACAAGAAGAACAGCGACCTGGCGGTGTTCTTCGGCAGCCAGACGACCAACAGGCCCAGGGTCTACAACA
CCAACGAGGCCAACGCCAACGCCCGTATCTCGGCGATGCTGCCCTATGTCCTGGCCGCCTCGCGCTTCGC
CCACTATCTCAAGGTGATCATGCGCGACAAGGTCGGCAGCTTCATGACCCGCGACAACGTGCAGACCTAC
CTGAACAATTGGATCGCCGACTACGTGCTGATCAACGACAACGCCCCGCAGGAGATCAAGGCGCAGTATC
CGCTGCGCGAAGCGCGGGTGGACGTTTCGGAAGTCGTCGGCAAACCGGGCGTCTATCGCGCCACGGTGTT
CCTCCGCCCGCACTTCCAACTGGAAGAGCTGACCGCCTCGATCCGCCTGGTCGCCACGCTGCCGCCGCCG
GCCGCGGCCTGA