SecReT6
Protein ID: 482902452
SecReT6 ID756
T6SS typei4a
Gene symbol-
Locus tagAvCA6_50820
StrainAzotobacter vinelandii CA6
Repliconchromosome [GenBank: NC_021150] [Browse all T6SS(s) in this replicon]
Location [Strand]5109308..5109805 [+]
ProductDUF796 family protein
NoteTssD
UniProt IDM9YP13
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 6.70E-36, Aligned region: 10..139
Protein Sequence: 165 a.a.     [Download]
>gi|482902452|ref|YP_007900959.1| DUF796 family protein [Azotobacter vinelandii CA6]
MDAIILDLGDDIKGDSQIEGYTDKIELMSYSHNVAMQVTNDISNSERTSGKPHIGEFTVTKFVDTSTPSL
NEYCCAGKAIPEVKITVGRNAAESDGKILPFIVYTLNNVVLSNVSVSGGAGGKPVETLSLNFTKIKWELT
AQKNDGSKEGTAASTWDLAANKVVK
 
Nucleotide Sequence: 498 bp     [Download]
>gi|482897536|ref|NC_021150.1|:5109308-5109805 Azotobacter vinelandii CA6, complete genome
ATGGATGCGATCATTCTCGACCTCGGCGACGACATCAAAGGCGACAGCCAGATCGAAGGCTACACCGACA
AGATCGAGCTGATGTCCTACAGCCACAACGTGGCCATGCAAGTCACCAACGACATCAGCAACTCGGAGCG
TACCTCCGGCAAGCCGCACATCGGCGAATTCACCGTCACCAAGTTCGTCGATACCTCGACTCCCTCGCTC
AACGAATACTGCTGCGCCGGCAAGGCCATCCCCGAGGTGAAGATCACCGTCGGCCGCAACGCCGCCGAGA
GCGACGGCAAGATCCTGCCCTTCATCGTCTACACCCTGAACAACGTGGTGCTCTCCAACGTCAGCGTCAG
CGGCGGGGCGGGCGGCAAGCCGGTCGAGACGCTGTCGCTCAACTTCACCAAGATCAAGTGGGAGCTGACC
GCGCAGAAGAACGATGGCAGCAAGGAAGGCACGGCCGCCTCGACCTGGGACCTGGCCGCCAACAAGGTCG
TCAAGTAA