SecReT6
Protein ID: 482902453
SecReT6 ID756
T6SS typei4a
Gene symbol-
Locus tagAvCA6_50830
StrainAzotobacter vinelandii CA6
Repliconchromosome [GenBank: NC_021150] [Browse all T6SS(s) in this replicon]
Location [Strand]5109821..5110273 [+]
Producthypothetical protein
NoteTssE
UniProt IDM9YNE8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 2.20E-21, Aligned region: 30..125
Protein Sequence: 150 a.a.     [Download]
>gi|482902453|ref|YP_007900960.1| hypothetical protein AvCA6_50830 [Azotobacter vinelandii CA6]
MGASGTGIRPPLFERLAATAEDRGSADFDRQALADSVRGELLRLLNTRRGSRPLTTPASVLDYGIADWSA
LQAERSADRRQLSREIRDAILRFEPRLQPGEIELLSIEGQRQRLRVRLNGVLRGGERCWPVSFLIEDGAD
GFEVRHERLD
 
Nucleotide Sequence: 453 bp     [Download]
>gi|482897536|ref|NC_021150.1|:5109821-5110273 Azotobacter vinelandii CA6, complete genome
ATGGGCGCCTCCGGCACGGGCATCCGGCCGCCGCTGTTCGAGCGGCTGGCCGCCACGGCGGAAGACCGCG
GCAGCGCGGATTTCGACCGGCAAGCGCTGGCCGACTCGGTGCGCGGCGAGCTGCTGCGGCTACTCAACAC
CCGCCGCGGCTCGCGGCCGCTCACCACCCCGGCGAGCGTGCTCGACTACGGCATCGCCGACTGGAGCGCG
CTGCAGGCCGAACGCAGCGCCGACCGCCGGCAGTTGAGCCGGGAAATCCGCGACGCCATCCTGCGGTTCG
AACCGCGCCTGCAACCGGGCGAAATCGAGCTGCTGTCCATCGAGGGCCAGCGCCAGCGACTGCGCGTGCG
CCTGAACGGCGTCCTGCGCGGCGGGGAGCGGTGCTGGCCGGTGTCGTTCCTGATCGAGGACGGCGCGGAC
GGTTTCGAGGTGCGCCATGAGCGACTCGATTGA