SecReT6
Protein ID: 482902457
SecReT6 ID756
T6SS typei4a
Gene symbol-
Locus tagAvCA6_50870
StrainAzotobacter vinelandii CA6
Repliconchromosome [GenBank: NC_021150] [Browse all T6SS(s) in this replicon]
Location [Strand]5116310..5118316 [+]
ProductRhs element Vgr protein
NoteTssI
UniProt IDM9YP18
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 6.70E-70, Aligned region: 30..323
Phage_GPD [PF05954], Evalue: 6.70E-70, Aligned region: 568..610
Phage_base_V [PF04717], Evalue: 1.10E-22, Aligned region: 95..117
Phage_base_V [PF04717], Evalue: 1.10E-22, Aligned region: 351..444
Gp5_C [PF06715], Evalue: 1.40E-11, Aligned region: 501..523
Gp5_C [PF06715], Evalue: 1.40E-11, Aligned region: 526..532
Gp5_C [PF06715], Evalue: 1.40E-11, Aligned region: 536..557
Gp5_C [PF06715], Evalue: 1.40E-11, Aligned region: 560..583
Gp5_C [PF06715], Evalue: 1.40E-11, Aligned region: 641..654
Protein Sequence: 668 a.a.     [Download]
>gi|482902457|ref|YP_007900964.1| Rhs element Vgr protein [Azotobacter vinelandii CA6]
MPRPTDITTSLSLTTSALANLFPEQLSGEERLNGLGSLQLHSYSAAAPTLDSVVATHLTATLHNDADLRP
LDALIAEVRQLPGDASADRYQVLLRPWLWWLTLASNNRVFQNKTTGEIVTGIFDGHGFGDYRLKLSGSYT
PREYCVQYSETDFAFVSRLLEEEGIFWFFTHEEGRHTLVLADGNDAFPAIPNGPKVPYLSQEIGVRELHG
VRSAQYCIQAVAGAYSATDYEFTTPTTSLYSRAEALAGSFSSYEHPGGYIAKARGDALTKQRVDGLRSQE
KRLIGESDCRWLVPGHWFTLTGHDDANLNIDWVVTSVTHEASHEHYRNRFEAIPKATNYRPPRATPKPRM
HTQTARVVGKAGEEIWTDQYGRIKIQFPWDREGRNDETSSCWVRVVLPWSGKNFGMQFVPRIGQEVIVTF
IDGDPDRPLVTGCVYNGDNALPYALPANQTQSGIKTNSSKGGGGFNELRFEDKKDAEEVFLQAQKDLKIN
VLNDSTASVGHDETLTVQNARTRTVKDGDETVTLEKGNRSVTLQTGSDTLDVRDSRTVKVGSDQTHSTGG
DYSHTVTGDYSLTVNGNLTIKVSGTLTLQSSGDFTARSDLSLTQQAGTSISQKAGTSFANQAGTSLDNKA
GTTLVNDAGISLTNKAGAEQTVDGGGLLTLKGGLVKIN
 
Nucleotide Sequence: 2007 bp     [Download]
>gi|482897536|ref|NC_021150.1|:5116310-5118316 Azotobacter vinelandii CA6, complete genome
ATGCCCCGTCCCACCGACATTACTACCAGCCTTTCTCTGACCACTTCGGCCCTGGCGAATCTGTTTCCGG
AGCAGCTCTCCGGCGAGGAGCGGCTGAACGGCCTCGGTAGCCTGCAGTTGCACAGCTATAGCGCCGCCGC
ACCGACGCTGGACAGCGTGGTGGCTACGCACCTGACCGCGACGCTGCACAACGATGCCGACTTGCGCCCG
CTGGACGCGCTAATCGCGGAAGTCCGCCAATTGCCCGGCGACGCGAGCGCCGACCGTTACCAAGTACTCC
TGCGCCCTTGGCTCTGGTGGCTGACCCTGGCCAGCAACAACCGGGTGTTCCAGAACAAGACCACGGGCGA
GATCGTCACCGGCATCTTCGATGGCCATGGCTTCGGCGATTACCGGTTGAAGCTCTCCGGCAGCTACACG
CCGCGCGAGTACTGCGTGCAGTACAGCGAGACGGATTTCGCCTTCGTCTCGCGGCTGCTGGAGGAGGAAG
GCATCTTCTGGTTCTTCACCCATGAAGAGGGCAGGCACACCCTGGTGCTGGCCGACGGCAACGATGCCTT
CCCAGCGATCCCCAACGGGCCGAAAGTACCCTATCTGAGCCAGGAAATCGGCGTGCGCGAGCTGCACGGC
GTGCGTTCGGCGCAGTACTGCATCCAGGCGGTGGCCGGGGCCTACAGTGCGACCGACTACGAATTCACCA
CGCCCACTACCTCGCTCTACAGCCGGGCCGAGGCGCTGGCCGGGTCATTTTCCAGCTACGAGCATCCCGG
CGGCTACATCGCCAAGGCGCGCGGCGACGCGCTGACCAAGCAGCGGGTGGACGGCCTGCGCAGCCAGGAA
AAGCGCCTGATCGGCGAGAGCGACTGCCGCTGGCTGGTGCCGGGGCACTGGTTCACCCTCACCGGACACG
ACGACGCCAACCTGAACATCGACTGGGTGGTGACCTCGGTGACCCACGAGGCCAGCCACGAGCACTACCG
CAACCGCTTCGAGGCGATCCCGAAGGCCACCAACTACCGTCCCCCGCGCGCGACGCCCAAGCCACGCATG
CACACCCAGACGGCCAGGGTGGTCGGCAAGGCCGGCGAGGAGATCTGGACCGACCAGTACGGCCGGATCA
AGATCCAGTTCCCCTGGGACCGCGAGGGGCGGAACGACGAGACCAGTTCCTGCTGGGTGCGCGTGGTATT
GCCCTGGAGCGGCAAGAACTTCGGCATGCAGTTCGTTCCGCGCATCGGCCAGGAGGTGATCGTCACCTTC
ATCGACGGCGATCCGGACCGGCCGCTGGTCACCGGCTGCGTCTACAACGGCGACAACGCCCTGCCCTACG
CGCTGCCGGCCAACCAGACGCAATCGGGCATCAAGACCAATTCGTCCAAGGGCGGCGGCGGTTTCAACGA
GCTGCGCTTCGAGGACAAGAAGGATGCCGAGGAGGTCTTCCTGCAGGCGCAGAAGGACCTGAAGATCAAC
GTGCTCAACGACAGCACGGCCAGCGTCGGCCACGACGAGACGCTGACGGTGCAGAACGCCCGCACCCGCA
CGGTGAAGGACGGCGACGAGACCGTCACCCTGGAAAAGGGCAACCGTAGCGTCACCCTGCAGACCGGCAG
CGATACCCTGGACGTCAGGGACAGCCGTACGGTGAAGGTCGGCAGCGACCAGACCCACAGCACCGGCGGC
GACTACAGCCACACGGTGACCGGCGACTACAGCCTGACGGTGAACGGCAATCTGACCATCAAGGTGAGCG
GCACCCTGACCCTGCAGAGCAGCGGCGACTTCACCGCCAGGAGCGACCTGTCGCTGACCCAGCAGGCCGG
TACCTCGATCAGCCAGAAGGCCGGCACCTCCTTCGCCAACCAGGCCGGTACCTCGCTGGACAACAAGGCC
GGCACCACCCTGGTCAACGACGCCGGCATCAGCCTGACCAACAAGGCCGGCGCCGAGCAGACGGTGGATG
GCGGCGGCCTGCTGACCCTCAAGGGCGGCCTGGTCAAGATCAACTGA