SecReT6
Protein ID: 482905193
SecReT6 ID757
T6SS typei3
Gene symbol-
Locus tagSTU288_13300
StrainSalmonella enterica subsp. enterica serovar Typhimurium str. U288
Repliconchromosome [GenBank: NC_021151] [Browse all T6SS(s) in this replicon]
Location [Strand]2757038..2759227 [-]
Productputative cytoplasmic protein
NoteTssI
UniProt IDM9XV29
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.70E-79, Aligned region: 121..429
Phage_base_V [PF04717], Evalue: 2.20E-26, Aligned region: 467..559
Phage_base_V [PF04717], Evalue: 2.20E-26, Aligned region: 663..685
Protein Sequence: 729 a.a.     [Download]
>gi|482905193|ref|YP_007903753.1| putative cytoplasmic protein [Salmonella enterica subsp. enterica serovar Typhimurium str. U288]
MSFVSTNNKSGMGGLTTTTPPITGESGGVTADSVAGSVADAAESAVEQAAGSLFGALPEPSGLVKAAVAA
AQAAAAAGMAQDAVSAIVSAVAGGPGAHNVTVSGSAVPPGALLFASLDGGETLSELFSYVVQLKTPDTLN
LGYVSPAANLPLKPMVGKDLCVNIELDGGGKRHISGLVTAARVVGHEGRSVTYELRMEPWVKLLTHTSDY
KAFQNKTVVDILDEVLAEYPYPVEKRLVESYPVRTWQVQYGETDFDFLQRLMQEWGIYWWFEHSEDSHTL
VLADAISAHKACPDSPLVEWHQEGLKLDKEFIHTITANESLRTGQWVLDDFDFTKPRSLLANTVANPRET
GHATYEHYEWPGDYFDKSEGEMLTRIRMEAQRSPGSRVLGGGNIRTLMTGYTFTLENYPTAEVNQEYLLM
QTLLFVQDNAQHSGQDQHFTFSTRFELHPTREVFRPQRTVSKPHTKGPQSAIVTGPAGQEIWTDQYGRVK
VQFGWDRYGKMDENSSCWIRVSYPWAGKGFGMIQIPRIGQEVLVDFKNGDPDLPIIVGRTYNQDTMPPWG
LPGMASQSGIFSHSLYGGPTNGNMLRFDDKTGAEEVKFHAEKDLNTTVKNNETHTVMVDRTKTIIKNETN
SIGEDRNTTVTKNDGLSVKLAQTINIGTTYRLDVGDQFTLRCGNAALVLHKDGSIEFCGKQLMLHTSDVM
QLIGKGIDMNPDGGTAVTADDIAPLLTSE
 
Nucleotide Sequence: 2190 bp     [Download]
>gi|482902549|ref|NC_021151.1|:c2759227-2757038 Salmonella enterica subsp. enterica serovar Typhimurium str. U288, complete genome
ATGAGTTTTGTATCCACAAATAATAAATCCGGTATGGGAGGGCTGACGACAACCACGCCGCCGATAACCG
GAGAAAGTGGCGGTGTCACCGCAGATTCAGTCGCCGGAAGCGTGGCAGATGCGGCGGAATCCGCCGTGGA
ACAGGCTGCGGGATCGCTATTTGGCGCATTGCCGGAGCCATCAGGACTGGTGAAAGCCGCGGTAGCAGCG
GCGCAGGCTGCCGCCGCCGCAGGTATGGCGCAGGATGCGGTATCGGCCATCGTCTCTGCTGTTGCAGGCG
GGCCGGGGGCGCATAATGTGACGGTCAGCGGCAGCGCCGTACCGCCGGGCGCATTACTGTTCGCCAGCCT
GGACGGCGGCGAAACATTAAGTGAACTGTTCAGCTATGTGGTACAGCTAAAAACGCCCGACACCCTGAAT
CTGGGCTATGTCTCCCCGGCGGCCAACCTGCCGCTCAAACCGATGGTGGGCAAAGATCTGTGCGTCAACA
TCGAACTGGATGGTGGCGGTAAACGACATATCAGCGGGCTGGTCACGGCGGCGCGGGTGGTGGGCCATGA
AGGGCGTTCGGTTACCTATGAGCTGCGTATGGAGCCGTGGGTAAAACTGCTGACCCATACCAGCGACTAC
AAAGCATTCCAGAATAAAACCGTGGTGGATATTCTGGATGAGGTTCTGGCGGAATATCCCTACCCGGTGG
AAAAGCGGCTGGTGGAAAGCTACCCGGTACGCACCTGGCAGGTGCAGTACGGTGAAACTGATTTTGATTT
TCTTCAGCGACTGATGCAGGAGTGGGGCATCTACTGGTGGTTTGAGCACAGCGAGGACAGCCACACGCTG
GTGCTGGCGGATGCCATCAGCGCCCACAAAGCATGTCCGGACTCGCCGCTGGTCGAGTGGCACCAGGAAG
GGCTGAAGCTGGACAAGGAGTTTATCCACACTATCACGGCAAACGAGAGCCTGCGGACTGGACAGTGGGT
GCTGGATGATTTCGATTTTACGAAGCCACGTTCATTGCTGGCAAACACCGTGGCAAACCCGCGTGAAACC
GGTCATGCCACCTACGAGCATTATGAGTGGCCGGGAGACTACTTCGACAAGAGTGAAGGCGAGATGCTGA
CGCGCATTCGTATGGAAGCGCAGCGCAGCCCCGGCAGTCGGGTGCTGGGGGGAGGGAATATCCGCACACT
CATGACCGGTTATACCTTCACGCTGGAAAACTATCCCACCGCCGAAGTCAATCAGGAATATCTGCTGATG
CAGACCTTGCTGTTTGTGCAGGACAACGCGCAGCACAGCGGGCAGGACCAGCACTTTACCTTTTCCACCC
GTTTTGAACTGCACCCCACCCGCGAGGTGTTCCGCCCGCAGCGGACGGTGAGCAAACCCCACACCAAAGG
GCCGCAGAGCGCCATCGTCACCGGCCCGGCGGGCCAGGAAATCTGGACGGATCAGTACGGGCGGGTAAAG
GTACAGTTTGGTTGGGATCGCTACGGCAAAATGGATGAAAACAGCTCCTGCTGGATACGCGTCAGCTACC
CGTGGGCGGGCAAAGGCTTCGGGATGATCCAGATCCCGCGTATCGGCCAGGAAGTGCTGGTGGATTTCAA
AAACGGCGATCCGGATCTGCCGATCATCGTGGGGCGTACCTACAACCAGGACACCATGCCGCCGTGGGGA
CTGCCGGGAATGGCGTCGCAGAGCGGGATCTTCAGCCACTCGCTGTATGGCGGGCCAACGAACGGCAACA
TGCTGCGTTTTGACGACAAAACGGGCGCGGAGGAAGTGAAGTTCCACGCGGAAAAAGATCTCAACACCAC
GGTGAAGAATAATGAAACGCATACGGTTATGGTGGATCGCACTAAAACCATTATTAAAAATGAAACCAAC
AGTATTGGTGAGGACAGAAACACCACGGTAACGAAGAATGACGGCCTTTCCGTAAAACTGGCGCAGACGA
TCAATATCGGCACCACTTATCGTTTAGATGTTGGCGATCAATTCACGCTTCGCTGCGGCAATGCGGCGCT
TGTTTTACATAAGGACGGCTCCATTGAGTTTTGTGGCAAGCAACTGATGTTACATACCAGCGATGTCATG
CAACTGATTGGTAAAGGTATTGATATGAACCCGGATGGCGGCACAGCCGTAACCGCCGATGATATTGCCC
CCCTTCTCACCTCTGAGTGA