SecReT6
Protein ID: 482905216
SecReT6 ID757
T6SS typei3
Gene symbol-
Locus tagSTU288_13415
StrainSalmonella enterica subsp. enterica serovar Typhimurium str. U288
Repliconchromosome [GenBank: NC_021151] [Browse all T6SS(s) in this replicon]
Location [Strand]2783380..2784435 [+]
Productputative cytoplasmic protein
NoteTssA
UniProt IDM9XP29
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.60E-18, Aligned region: 51..110
ImpA-rel_N [PF06812], Evalue: 1.60E-18, Aligned region: 224..241
Protein Sequence: 351 a.a.     [Download]
>gi|482905216|ref|YP_007903776.1| putative cytoplasmic protein [Salmonella enterica subsp. enterica serovar Typhimurium str. U288]
MDMSLTKPVSAEQPCGPDPEYDPEYLLLFSRAAPQAEAQYGDFVSTPEAVNWPEIERDARRLLTRSKDIR
VLILLLRSRIQQAGAQGLAEMLTQLAELSVIWSDALHPQLLTGEGASAESIEDASLARSNALAALLDHEG
VMADIRGITLSNSAALRLQVRDVERALSAPRPADALAPESVRQQLADLEARGALPLAAFREAQESAERLQ
VWARETLGDLAPDFSRLRQLLALLPDVVQTTTPEIPPSPAPVPDPAGTVMDNAVPARAEDVPPVNAPPGI
SLPHNAEPGPIRDRNDALERLRCIRRWFESSEPSSPTIPLLRQAERLVGKRFSEVINEIPVELLEKWDAL
E
 
Nucleotide Sequence: 1056 bp     [Download]
>gi|482902549|ref|NC_021151.1|:2783380-2784435 Salmonella enterica subsp. enterica serovar Typhimurium str. U288, complete genome
ATGGACATGTCCCTGACTAAACCGGTAAGCGCGGAACAACCCTGCGGCCCCGATCCGGAGTACGATCCGG
AATACCTGCTGCTGTTCAGCCGCGCCGCCCCCCAGGCGGAGGCGCAATATGGTGATTTTGTCAGTACGCC
GGAAGCCGTGAACTGGCCGGAAATTGAACGTGATGCGCGCCGTCTGCTCACGCGCAGTAAGGATATCCGG
GTGTTGATCCTGCTGCTGCGCAGTCGCATCCAGCAGGCTGGCGCACAGGGACTGGCGGAAATGCTCACAC
AACTGGCAGAACTGAGCGTAATCTGGTCTGATGCACTCCATCCACAGCTGCTTACCGGCGAAGGCGCATC
CGCAGAATCTATTGAAGATGCGTCGCTGGCGCGCAGTAATGCCCTGGCGGCGCTGCTGGATCACGAAGGC
GTGATGGCGGACATTCGCGGTATTACGCTGTCAAACAGTGCCGCCCTGCGCCTACAGGTACGGGATGTGG
AGCGCGCGTTATCCGCTCCCCGCCCGGCTGATGCGCTGGCCCCCGAATCCGTCCGCCAGCAACTGGCCGA
CCTCGAAGCCCGTGGGGCATTACCGCTGGCGGCGTTTCGCGAAGCGCAGGAAAGCGCAGAACGCCTGCAA
GTGTGGGCGCGTGAGACATTAGGCGATCTGGCTCCAGATTTTTCACGCCTGCGGCAGTTGTTAGCGCTGC
TGCCTGACGTGGTACAGACAACCACACCGGAAATCCCTCCGTCGCCAGCGCCAGTGCCAGACCCCGCAGG
CACGGTTATGGATAATGCCGTTCCGGCACGGGCAGAGGATGTGCCGCCTGTCAACGCGCCACCCGGTATA
TCCCTCCCACACAATGCTGAACCGGGGCCAATTCGCGATCGTAATGATGCGCTGGAACGCCTGCGGTGCA
TTCGTCGCTGGTTTGAGAGCAGTGAACCCAGTAGCCCGACCATCCCACTGTTACGCCAGGCTGAAAGACT
GGTGGGAAAACGGTTCTCGGAGGTGATCAATGAGATCCCGGTGGAGTTGCTGGAGAAGTGGGATGCCCTG
GAGTGA