SecReT6
Protein ID: 482905228
SecReT6 ID757
T6SS typei3
Gene symbol-
Locus tagSTU288_13475
StrainSalmonella enterica subsp. enterica serovar Typhimurium str. U288
Repliconchromosome [GenBank: NC_021151] [Browse all T6SS(s) in this replicon]
Location [Strand]2800034..2802607 [-]
Productprotein disaggregation chaperone
NoteTssH
UniProt IDM9XV65
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 6.00E-58, Aligned region: 202..280
AAA_2 [PF07724], Evalue: 6.00E-58, Aligned region: 596..760
ClpB_D2-small [PF10431], Evalue: 3.20E-28, Aligned region: 766..845
AAA [PF00004], Evalue: 5.60E-28, Aligned region: 203..337
AAA [PF00004], Evalue: 5.60E-28, Aligned region: 431..453
AAA [PF00004], Evalue: 5.60E-28, Aligned region: 602..728
Clp_N [PF02861], Evalue: 7.10E-28, Aligned region: 17..68
Clp_N [PF02861], Evalue: 7.10E-28, Aligned region: 94..145
AAA_5 [PF07728], Evalue: 6.60E-20, Aligned region: 203..228
AAA_5 [PF07728], Evalue: 6.60E-20, Aligned region: 431..466
AAA_5 [PF07728], Evalue: 6.60E-20, Aligned region: 601..721
AAA_5 [PF07728], Evalue: 6.60E-20, Aligned region: 730..761
AAA_16 [PF13191], Evalue: 1.90E-15, Aligned region: 180..223
AAA_16 [PF13191], Evalue: 1.90E-15, Aligned region: 245..288
AAA_16 [PF13191], Evalue: 1.90E-15, Aligned region: 435..477
AAA_16 [PF13191], Evalue: 1.90E-15, Aligned region: 571..637
AAA_16 [PF13191], Evalue: 1.90E-15, Aligned region: 667..695
Sigma54_activat [PF00158], Evalue: 7.10E-10, Aligned region: 181..221
Sigma54_activat [PF00158], Evalue: 7.10E-10, Aligned region: 599..738
AAA_22 [PF13401], Evalue: 6.30E-09, Aligned region: 199..283
AAA_22 [PF13401], Evalue: 6.30E-09, Aligned region: 324..419
AAA_22 [PF13401], Evalue: 6.30E-09, Aligned region: 599..695
AAA_18 [PF13238], Evalue: 1.40E-07, Aligned region: 204..272
AAA_18 [PF13238], Evalue: 1.40E-07, Aligned region: 603..620
AAA_18 [PF13238], Evalue: 1.40E-07, Aligned region: 779..794
AAA_17 [PF13207], Evalue: 1.40E-07, Aligned region: 204..280
AAA_17 [PF13207], Evalue: 1.40E-07, Aligned region: 605..659
AAA_17 [PF13207], Evalue: 1.40E-07, Aligned region: 784..832
IstB_IS21 [PF01695], Evalue: 1.10E-06, Aligned region: 197..260
IstB_IS21 [PF01695], Evalue: 1.10E-06, Aligned region: 501..528
IstB_IS21 [PF01695], Evalue: 1.10E-06, Aligned region: 601..621
RuvB_N [PF05496], Evalue: 3.80E-05, Aligned region: 203..283
RuvB_N [PF05496], Evalue: 3.80E-05, Aligned region: 328..378
RuvB_N [PF05496], Evalue: 3.80E-05, Aligned region: 565..622
RuvB_N [PF05496], Evalue: 3.80E-05, Aligned region: 671..699
AAA_28 [PF13521], Evalue: 7.30E-05, Aligned region: 203..341
AAA_28 [PF13521], Evalue: 7.30E-05, Aligned region: 601..620
Zeta_toxin [PF06414], Evalue: 0.0001, Aligned region: 198..223
Zeta_toxin [PF06414], Evalue: 0.0001, Aligned region: 316..332
Zeta_toxin [PF06414], Evalue: 0.0001, Aligned region: 601..653
Zeta_toxin [PF06414], Evalue: 0.0001, Aligned region: 780..795
AAA_25 [PF13481], Evalue: 0.00012, Aligned region: 203..276
AAA_25 [PF13481], Evalue: 0.00012, Aligned region: 436..488
AAA_25 [PF13481], Evalue: 0.00012, Aligned region: 597..620
Arch_ATPase [PF01637], Evalue: 0.00013, Aligned region: 182..222
Arch_ATPase [PF01637], Evalue: 0.00013, Aligned region: 254..287
Arch_ATPase [PF01637], Evalue: 0.00013, Aligned region: 434..434
Arch_ATPase [PF01637], Evalue: 0.00013, Aligned region: 603..626
Arch_ATPase [PF01637], Evalue: 0.00013, Aligned region: 668..683
Arch_ATPase [PF01637], Evalue: 0.00013, Aligned region: 770..806
RNA_helicase [PF00910], Evalue: 0.00034, Aligned region: 204..224
RNA_helicase [PF00910], Evalue: 0.00034, Aligned region: 602..623
RNA_helicase [PF00910], Evalue: 0.00034, Aligned region: 708..720
Bac_DnaA [PF00308], Evalue: 0.00054, Aligned region: 198..224
Bac_DnaA [PF00308], Evalue: 0.00054, Aligned region: 397..456
Bac_DnaA [PF00308], Evalue: 0.00054, Aligned region: 596..627
AAA_19 [PF13245], Evalue: 0.00073, Aligned region: 199..239
AAA_19 [PF13245], Evalue: 0.00073, Aligned region: 604..623
NACHT [PF05729], Evalue: 0.001, Aligned region: 203..231
NACHT [PF05729], Evalue: 0.001, Aligned region: 603..621
Mg_chelatase [PF01078], Evalue: 0.001, Aligned region: 198..221
Mg_chelatase [PF01078], Evalue: 0.001, Aligned region: 600..628
Mg_chelatase [PF01078], Evalue: 0.001, Aligned region: 672..700
AAA_3 [PF07726], Evalue: 0.0014, Aligned region: 204..223
AAA_3 [PF07726], Evalue: 0.0014, Aligned region: 671..719
DUF815 [PF05673], Evalue: 0.0016, Aligned region: 187..227
DUF815 [PF05673], Evalue: 0.0016, Aligned region: 442..470
DUF815 [PF05673], Evalue: 0.0016, Aligned region: 600..640
DUF258 [PF03193], Evalue: 0.0022, Aligned region: 192..222
DUF258 [PF03193], Evalue: 0.0022, Aligned region: 602..620
ResIII [PF04851], Evalue: 0.0024, Aligned region: 185..224
ResIII [PF04851], Evalue: 0.0024, Aligned region: 267..288
ResIII [PF04851], Evalue: 0.0024, Aligned region: 573..617
ResIII [PF04851], Evalue: 0.0024, Aligned region: 755..790
T2SE [PF00437], Evalue: 0.0036, Aligned region: 192..222
T2SE [PF00437], Evalue: 0.0036, Aligned region: 591..679
ABC_tran [PF00005], Evalue: 0.0038, Aligned region: 203..224
ABC_tran [PF00005], Evalue: 0.0038, Aligned region: 425..479
ABC_tran [PF00005], Evalue: 0.0038, Aligned region: 603..624
MobB [PF03205], Evalue: 0.0042, Aligned region: 204..225
MobB [PF03205], Evalue: 0.0042, Aligned region: 602..624
AAA_29 [PF13555], Evalue: 0.0087, Aligned region: 197..219
AAA_29 [PF13555], Evalue: 0.0087, Aligned region: 600..622
Protein Sequence: 857 a.a.     [Download]
>gi|482905228|ref|YP_007903788.1| protein disaggregation chaperone [Salmonella enterica subsp. enterica serovar Typhimurium str. U288]
MRLDRLTNKFQLALADAQSLALGHDNQFIEPLHLMSALLNQEGGSIRPLLTSAGINAGQLRTAIDQALSR
LPQVEGTGGDVQPSSELVRVLNLCDKLAQKRGDNFISSELFVLAALESRGTLTDLLKSAGATTANITQAI
EQMRGGESVNDQGAEDQRQALKKYTVDLTERAEQGKLDPVIGRDEEIRRTIQVLQRRTKNNPVLIGEPGV
GKTAIVEGLAQRIINGEVPEGLKGRRVLALDMGALVAGAKYRGEFEERLKGVLNDLAKQEGNVILFIDEL
HTMVGAGKADGAMDAGNMLKPALARGELHCVGATTLDEYRQYIEKDAALERRFQKVFVAEPSVEDTIAIL
RGLKERYELHHHVQITDPAIVAAATLSHRYIADRQLPDKAIDLIDEAASSIRMQIDSKPEELDRLDRRII
QLKLEQQALMKESDEASKKRLDMLNEELDDKERQYSELEEEWKAEKASLSGTQTIKAELEQAKIAIEQAR
RVGDLARMSELQYGKIPELEKQLEAATQSEGKTMRLLRNKVTDAEIAEVLARWTGIPVSRMLEGEREKLL
RMEQELHSRVIGQNEAVEAVSNAIRRSRAGLSDPNRPIGSFLFLGPTGVGKTELCKALANFMFDSDDAMV
RIDMSEFMEKHSVSRLVGAPPGYVGYEEGGYLTEAVRRRPYSVILLDEVEKAHPDVFNILLQVLDDGRLT
DGQGRTVDFRNTVVIMTSNLGSDLIQERFGELDYGRMKEMVLGVVSQNFRPEFINRIDEVVVFHPLGEQH
IASIAQIQLQRLYKRLEERGYEIHISDEALKLLSANGYDPVYGARPLKRAIQQQIENPLAQQILSGELVP
GKVIRLEANDDRIVAVQ
 
Nucleotide Sequence: 2574 bp     [Download]
>gi|482902549|ref|NC_021151.1|:c2802607-2800034 Salmonella enterica subsp. enterica serovar Typhimurium str. U288, complete genome
ATGCGTCTGGATCGTCTTACTAACAAATTCCAGCTTGCTCTTGCCGATGCCCAGTCGCTCGCGCTGGGGC
ACGACAACCAATTCATCGAACCTCTTCATTTAATGAGCGCCTTGCTGAACCAGGAAGGGGGATCGATACG
TCCTTTATTAACCTCCGCCGGCATTAATGCTGGCCAGTTGCGCACCGCTATCGATCAGGCGCTGAGCCGT
TTACCGCAGGTGGAAGGCACCGGCGGCGACGTACAGCCTTCTTCGGAACTGGTACGCGTACTGAACCTTT
GCGACAAGCTGGCGCAAAAACGGGGAGACAATTTTATTTCGTCAGAGCTGTTTGTTCTGGCGGCGCTTGA
GTCTCGCGGCACGTTAACCGATCTGCTGAAATCAGCCGGTGCGACCACGGCCAATATCACTCAGGCAATT
GAACAGATGCGCGGAGGTGAAAGCGTGAACGATCAAGGGGCTGAAGACCAACGTCAGGCCTTGAAAAAAT
ATACCGTCGATCTGACCGAGCGGGCTGAACAAGGCAAGCTTGACCCGGTAATTGGTCGTGATGAAGAAAT
TCGCCGTACCATTCAGGTACTGCAACGTCGTACCAAAAACAACCCGGTGTTAATCGGTGAGCCAGGGGTC
GGTAAAACGGCAATTGTTGAAGGACTGGCGCAGCGCATTATTAACGGTGAAGTCCCTGAAGGCTTAAAAG
GTCGCCGCGTACTGGCGCTGGATATGGGCGCGCTGGTGGCGGGGGCGAAATATCGCGGCGAATTTGAAGA
GCGTCTGAAAGGCGTGCTGAACGATCTGGCGAAACAGGAAGGCAACGTCATCCTGTTTATTGACGAGCTG
CACACGATGGTTGGCGCAGGTAAGGCTGATGGCGCAATGGACGCCGGGAATATGCTGAAACCGGCGCTGG
CGCGTGGTGAACTGCACTGTGTGGGCGCCACCACGCTGGATGAATACCGTCAGTACATTGAAAAAGACGC
GGCGCTGGAACGTCGTTTTCAAAAAGTGTTTGTCGCAGAACCTTCAGTGGAAGACACCATCGCTATTCTG
CGTGGCCTGAAAGAACGTTACGAGCTGCACCACCATGTGCAGATCACTGACCCGGCGATTGTGGCGGCGG
CAACATTATCTCACCGCTATATCGCCGACCGTCAGTTGCCGGATAAAGCTATCGACCTCATCGATGAAGC
TGCATCCAGCATTCGTATGCAGATTGACTCTAAGCCGGAGGAGCTGGACAGACTCGACCGCCGCATTATT
CAGCTCAAACTGGAACAGCAGGCGTTGATGAAAGAGTCTGACGAGGCGAGTAAAAAACGTCTCGATATGC
TCAACGAAGAACTGGACGACAAAGAGCGCCAGTATTCTGAGCTGGAAGAAGAGTGGAAAGCGGAAAAAGC
GTCGCTCTCTGGTACGCAAACTATTAAAGCGGAGCTGGAGCAGGCGAAGATTGCCATCGAGCAGGCGCGT
CGCGTTGGCGACCTGGCGCGAATGTCTGAACTGCAGTACGGCAAAATTCCGGAGCTGGAAAAACAGCTGG
AAGCCGCGACCCAGTCGGAAGGTAAAACCATGCGTCTGTTACGTAACAAAGTAACGGATGCGGAAATTGC
CGAAGTGCTAGCGCGCTGGACCGGTATTCCGGTTTCCAGAATGCTGGAAGGCGAACGTGAAAAACTGTTG
CGTATGGAACAAGAGTTACACAGCCGTGTGATCGGGCAGAATGAAGCCGTTGAAGCAGTATCGAACGCCA
TACGTCGTAGCCGTGCTGGGCTGTCCGATCCGAACCGTCCGATTGGTTCCTTCCTGTTCCTGGGGCCGAC
GGGGGTCGGTAAAACCGAACTGTGTAAAGCACTGGCTAACTTTATGTTCGACAGCGACGACGCGATGGTG
CGTATCGACATGTCTGAGTTTATGGAGAAACACTCCGTGTCTCGTTTGGTCGGGGCGCCTCCGGGATATG
TCGGCTATGAAGAAGGCGGTTATTTGACGGAAGCGGTGCGCCGTCGCCCTTATTCCGTCATCTTGTTGGA
TGAAGTGGAAAAAGCGCATCCGGATGTATTCAACATTCTGTTGCAGGTGCTGGACGACGGTCGACTGACT
GACGGGCAGGGGAGAACGGTCGACTTCCGTAATACGGTGGTCATTATGACTTCTAACCTCGGTTCCGATC
TCATTCAGGAGCGCTTTGGCGAACTGGATTACGGTCGAATGAAAGAGATGGTGCTGGGTGTGGTTAGCCA
AAACTTCCGTCCGGAATTTATCAACCGTATTGATGAAGTTGTGGTATTCCATCCGTTAGGTGAACAACAC
ATCGCTTCTATTGCTCAGATCCAGCTGCAGCGTCTGTACAAACGTCTGGAAGAACGTGGTTATGAAATCC
ATATCTCCGACGAGGCGCTGAAACTGTTGAGCGCCAACGGTTACGATCCGGTCTACGGGGCGCGTCCGTT
AAAACGTGCTATTCAACAGCAGATCGAAAACCCACTGGCGCAGCAAATCCTGTCTGGTGAACTGGTTCCT
GGCAAAGTGATTCGCCTTGAAGCCAATGATGATCGTATTGTGGCAGTGCAGTAA