SecReT6
Protein ID: 487809500
SecReT6 ID790
T6SS typei1
Gene symbol-
Locus tagVCV52_A0125
StrainVibrio cholerae V52
Repliconchromosome [GenBank: NZ_AAKJ02000013] [Browse all T6SS(s) in this replicon]
Location [Strand]34662..36140 [-]
Producttype VI secretion protein
NoteTssC
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.10E-191, Aligned region: 65..490
Protein Sequence: 492 a.a.     [Download]
>gi|487809500|ref|WP_001882966.1| type VI secretion protein [Vibrio cholerae V52]
MMSTTEKVLERPQLAQGSLLDEIMAQTRIAPSEEGYDIAKKGVAAFIENLMGSQHSAEPVNKSLVDQMLV
ELDKKISAQMDEILHNSQFQAMESAWRGLKLFVDRTDFRENNKVEILHVTKDELLEDFEFAPETAQSGLY
KHVYSAGYGQFGGEPVGAIIGNYAFTPSTPDMKLLQYMGALGAMAHAPFISSVGPEFFGIDSFEELPNIK
DLKSTFESPKYTKWRSLRESEDARYLGLTAPRFLLRVPYDPIENPVKSFNYAENVSASHEHYLWGNTAFA
FATRLTDSFAKYRWCPNIIGPQSGGAVEDLPVHVFESMGALQSKIPTEVLITDRKEFELAEEGFIALTMR
KGSDNAAFFSANSIQKPKVFPNTKEGKEAETNYKLGTQLPYMMIINRLAHYVKVLQREQIGAWKERQDLE
RELNSWIKQYVADQENPPADVRSRRPLRAARIEVMDVEGNPGWYQVSLSVRPHFKYMGANFELSLVGRLD
QA
 
Nucleotide Sequence: 1479 bp     [Download]
>gi|121726954|gb|NZ_AAKJ02000013|VCV52_A0125|:34662-36140
ATGATGTCTACGACTGAAAAGGTATTGGAAAGGCCACAGCTTGCTCAAGGCAGCCTTCTTGATGAAATTA
TGGCGCAAACCCGTATCGCACCAAGCGAAGAGGGTTACGACATCGCGAAAAAAGGTGTTGCAGCGTTTAT
CGAAAATCTTATGGGTTCACAACACTCTGCTGAGCCTGTCAACAAATCTCTGGTTGACCAAATGTTGGTT
GAACTGGATAAGAAAATCAGTGCACAGATGGATGAAATCCTGCACAACTCGCAATTTCAAGCGATGGAAT
CGGCGTGGCGCGGTTTGAAGCTGTTCGTGGATCGCACTGATTTTCGTGAAAATAACAAAGTCGAAATCCT
TCACGTAACCAAAGATGAACTGCTGGAAGATTTCGAGTTTGCTCCAGAAACGGCTCAGTCCGGTCTTTAC
AAGCACGTTTATTCTGCCGGTTATGGTCAATTTGGTGGCGAACCTGTTGGCGCGATCATTGGTAACTATG
CGTTTACCCCTTCAACGCCAGATATGAAGCTGCTGCAATACATGGGCGCACTGGGTGCCATGGCGCATGC
TCCTTTCATTTCAAGCGTAGGTCCTGAATTCTTTGGTATCGATTCTTTTGAAGAACTGCCTAACATTAAA
GATCTCAAGTCGACATTTGAAAGCCCGAAATACACCAAATGGCGTTCATTGCGTGAATCGGAAGATGCGC
GCTATCTTGGTTTGACTGCGCCTCGTTTCCTGCTGCGTGTTCCTTACGATCCAATCGAAAATCCAGTGAA
GTCGTTCAATTATGCGGAAAACGTCAGTGCTTCGCACGAGCACTACCTGTGGGGTAACACGGCATTTGCC
TTCGCAACTCGTTTGACGGATAGCTTTGCTAAATATCGCTGGTGTCCAAACATTATCGGTCCACAAAGTG
GTGGTGCAGTTGAAGATCTGCCGGTGCATGTCTTTGAATCTATGGGTGCATTGCAAAGCAAGATCCCAAC
CGAAGTCCTGATCACGGACCGTAAAGAGTTTGAACTGGCGGAAGAAGGTTTTATTGCTCTTACTATGCGT
AAAGGCAGTGATAACGCGGCGTTCTTCTCTGCAAACTCCATTCAAAAACCTAAGGTTTTCCCAAATACCA
AAGAAGGCAAAGAAGCGGAAACCAACTACAAGTTGGGTACCCAGTTGCCGTACATGATGATCATCAACCG
TTTGGCGCACTATGTGAAAGTTCTGCAACGTGAGCAGATCGGTGCTTGGAAAGAGCGTCAAGATCTTGAG
CGTGAACTGAACTCATGGATCAAACAATACGTTGCTGATCAAGAGAACCCACCTGCAGACGTACGTAGCC
GTCGTCCACTTCGTGCTGCGCGCATTGAAGTGATGGATGTGGAAGGCAATCCAGGTTGGTATCAGGTGTC
GCTCTCGGTTCGTCCTCACTTTAAGTACATGGGTGCGAACTTTGAGTTGTCATTAGTTGGACGTCTTGAT
CAAGCCTGA