SecReT6
Protein ID: 487815977
SecReT6 ID790
T6SS typei1
Gene symbol-
Locus tagVCV52_A0131
StrainVibrio cholerae V52
Repliconchromosome [GenBank: NZ_AAKJ02000013] [Browse all T6SS(s) in this replicon]
Location [Strand]28235..29491 [-]
Producthypothetical protein
NoteTssK
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 3.50E-134, Aligned region: 19..391
GMP_synt_C [PF00958], Evalue: 0.00012, Aligned region: 63..139
GMP_synt_C [PF00958], Evalue: 0.00012, Aligned region: 302..374
Protein Sequence: 418 a.a.     [Download]
>gi|487815977|ref|WP_001889443.1| hypothetical protein [Vibrio cholerae V52]
MFARNRVIWNEGLFIKPQHFQQQQRYTEYCLDERLSTVSRYLYGISELSLNPEYLSFGRIAIERAVGVMP
DGTTFRIPQEDHLPDALEVTDASLANQIVYLAVPLRSESLMEINWPEERGTGRYVSRRLEVRDVHSVQGD
TTTIDVSPVRLQLMLEREDRSAYASIAIGRILEKRPDGSVVLDPDFIPCHLNVVGISALHRFINEMSGLM
RERAKNIAQRISSPAQGGVADVSDFMLLQALNRLQPQMKHLAELRSLHPERLFECLSCVCGELATFTDES
RLPPSLPSYNHDSPSHSFQPLIRSLRQSLSVVLEPRAVSIQLDKRKYGLMVAPIHDPQLMESAEFIIAVK
ARMPLDELRRLFTQQTKVASVEKIRELISLQLPGIPLTPITPSHRANCLTTLATPTTNWIKPALHGRC
 
Nucleotide Sequence: 1257 bp     [Download]
>gi|121726954|gb|NZ_AAKJ02000013|VCV52_A0131|:28235-29491
ATGTTTGCGCGTAACCGAGTGATCTGGAATGAAGGGCTATTTATTAAGCCGCAACATTTCCAGCAACAGC
AGAGATATACGGAGTACTGCCTAGACGAGCGCCTGAGCACCGTGAGCCGTTACTTGTATGGGATTTCCGA
GTTGTCGCTCAACCCGGAATACCTCTCGTTTGGCCGTATTGCGATTGAGCGAGCGGTCGGCGTGATGCCC
GATGGCACCACCTTTCGTATTCCTCAAGAAGATCATCTTCCCGATGCGCTCGAAGTGACCGATGCGTCAT
TGGCAAACCAGATTGTCTACTTAGCCGTACCGCTACGTAGTGAGTCGCTGATGGAGATTAACTGGCCAGA
AGAGCGTGGTACGGGGCGCTATGTCAGCCGTCGTCTCGAAGTGCGTGATGTCCACAGCGTGCAGGGTGAT
ACCACGACGATTGATGTTTCCCCTGTGCGTTTGCAACTCATGCTTGAGCGAGAGGATCGCAGTGCGTATG
CCTCAATTGCTATTGGCCGTATTTTAGAAAAACGTCCTGATGGCAGTGTGGTGCTCGATCCGGATTTCAT
CCCTTGTCACTTGAATGTGGTGGGCATCTCTGCGCTGCACCGCTTTATTAATGAGATGTCAGGCCTGATG
CGTGAGCGAGCGAAAAATATTGCTCAGCGGATCAGCTCTCCAGCACAAGGTGGGGTTGCTGATGTTTCGG
ACTTTATGCTGCTGCAAGCTTTAAACCGTCTGCAACCACAAATGAAGCATTTGGCAGAGCTGCGCAGCTT
ACACCCAGAGCGTCTGTTTGAATGTCTCTCGTGTGTGTGTGGTGAGCTGGCTACCTTTACTGACGAAAGT
CGTCTGCCGCCCAGTTTGCCAAGCTATAACCATGATTCACCCAGCCACTCTTTCCAGCCGCTGATCCGCA
GCTTGCGTCAGAGCTTGAGCGTGGTGCTAGAGCCGCGCGCCGTCTCTATCCAACTGGATAAACGTAAGTA
CGGTTTGATGGTTGCACCAATCCATGATCCGCAACTGATGGAGAGTGCAGAGTTTATCATCGCGGTTAAA
GCTCGCATGCCGTTGGATGAGCTACGCCGTCTGTTTACTCAGCAAACCAAAGTGGCATCGGTTGAGAAAA
TTCGTGAACTCATCTCACTGCAACTGCCGGGTATTCCATTGACGCCCATTACCCCGTCGCACCGCGCCAA
TTGCCTTACCACGCTGGCTACACCTACTACCAACTGGATAAAACCAGCGCTGCATGGGCGATGTTGA