SecReT6
Protein ID: 487815978
SecReT6 ID790
T6SS typei1
Gene symbol-
Locus tagVCV52_A0128
StrainVibrio cholerae V52
Repliconchromosome [GenBank: NZ_AAKJ02000013] [Browse all T6SS(s) in this replicon]
Location [Strand]31467..32420 [-]
Producthypothetical protein
NoteTssG
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.50E-93, Aligned region: 6..304
Protein Sequence: 317 a.a.     [Download]
>gi|487815978|ref|WP_001889444.1| hypothetical protein [Vibrio cholerae V52]
MSLPGNVREYNFYQLVELLQKLADINPESEEWERDCRLVFSANPSLGFSPSDVMALEARDDDRWVMLTNF
FGLSGAQSPLPGFILEQLVTEEPGGYKQPFLDFFNNRLINLVYRVWRKYRYYVRFQPGAQDVFSAQLFAL
VGLGDPDLRGETPINWCKMLAYAGTLAGRSRSPQVVAGIIAHCFDLPDVSIRQWVRRRVSIDRSQQLALG
KQNARLGMDTVIGESVIDCSGKFIICIKRLSRSRFADFLPSGKEYQPLCKLVEFILREQMAYDLELAMDE
REAPLFCLDAKQNIALGWTSFLGQDAANKHVLIQVRQ
 
Nucleotide Sequence: 954 bp     [Download]
>gi|121726954|gb|NZ_AAKJ02000013|VCV52_A0128|:31467-32420
TTGAGCTTGCCGGGCAATGTACGGGAATACAACTTCTACCAACTGGTTGAGCTGTTGCAAAAACTGGCTG
ATATCAATCCTGAATCGGAAGAGTGGGAGCGCGATTGCCGCTTGGTGTTCAGTGCTAACCCGAGCCTTGG
ATTTTCGCCTAGTGATGTGATGGCGCTTGAAGCGCGTGACGATGATCGCTGGGTTATGTTGACCAACTTT
TTTGGCCTTTCCGGTGCACAGTCACCTCTGCCGGGGTTCATCCTTGAGCAATTGGTGACGGAAGAGCCTG
GGGGGTATAAGCAGCCGTTTCTCGATTTTTTCAATAACCGATTGATTAATTTGGTTTATCGCGTTTGGCG
TAAATACCGTTACTACGTACGTTTTCAGCCCGGTGCGCAGGATGTGTTCTCTGCACAGCTGTTTGCGCTG
GTGGGGTTGGGCGATCCTGACCTTCGCGGTGAAACGCCGATCAACTGGTGCAAAATGCTGGCTTACGCGG
GCACGCTGGCCGGACGTAGCCGTTCGCCACAAGTCGTGGCCGGCATTATTGCTCACTGTTTTGATTTACC
GGATGTCTCCATTCGCCAGTGGGTCAGACGTCGGGTATCGATTGACCGGAGTCAGCAACTGGCGCTGGGC
AAGCAGAATGCGCGGTTGGGGATGGACACGGTGATTGGCGAGTCCGTTATTGATTGTAGTGGAAAATTTA
TTATCTGTATCAAACGGTTATCTCGCAGTCGTTTTGCTGATTTTTTGCCCTCCGGTAAAGAGTATCAGCC
ACTTTGCAAGCTGGTGGAGTTTATTTTGCGCGAACAGATGGCGTACGACCTCGAGCTGGCGATGGATGAA
CGGGAAGCGCCGCTGTTTTGTCTGGATGCGAAACAGAATATCGCCCTCGGCTGGACTTCGTTTCTTGGCC
AAGATGCAGCCAATAAACATGTGTTAATTCAAGTAAGGCAATAA