SecReT6
Protein ID: 487815979
SecReT6 ID790
T6SS typei1
Gene symbol-
Locus tagVCV52_A0138
StrainVibrio cholerae V52
Repliconchromosome [GenBank: NZ_AAKJ02000013] [Browse all T6SS(s) in this replicon]
Location [Strand]16203..17468 [-]
Producttype VI secretion protein
NoteTssA
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 5.90E-11, Aligned region: 47..100
Cytochrom_B562 [PF07361], Evalue: 0.0025, Aligned region: 120..136
Cytochrom_B562 [PF07361], Evalue: 0.0025, Aligned region: 172..185
Cytochrom_B562 [PF07361], Evalue: 0.0025, Aligned region: 325..397
Protein Sequence: 421 a.a.     [Download]
>gi|487815979|ref|WP_001889445.1| type VI secretion protein [Vibrio cholerae V52]
MMSNVIFIDNVCYRLTNDSEEIRGLEPYAKVREEINRRFNPIAGGTDWAVVKEYCEQLACNQGMDFLICG
YYAVACLKTQGLAGYATGMELMSASLANQGEYDVKSAKVRKEILDWVNARVVQELKALKPTYESLRDLYR
AERHCERLHQLFEQQQTEYKVDFEGVGFALFEHIDRIETQYHSLLKKQEKAQPPKLKFWQRGYALFTLGV
LGVALGVVGGYWGWPWFYTTPYAAPQRITTLNEASQTQALLNDSSTSERARWQHDLIPLYRDTLQQNLTI
SFSEPKRHAITQLNLLRTLYPENEQVNALSQEFAIQQQQALEQTALFVAKFSEIRTKMANIALLAKRGKW
AELEKQTKSLEEFAVSLSPIYGRVDYVQGLLEQGDVTNAQKEFAILKQRLDSLSWKIAELEQRIGDAALL
Q
 
Nucleotide Sequence: 1266 bp     [Download]
>gi|121726954|gb|NZ_AAKJ02000013|VCV52_A0138|:16203-17468
GTGATGTCCAATGTGATTTTTATTGATAACGTTTGCTACCGATTAACCAATGATTCTGAGGAGATTCGCG
GATTAGAGCCCTATGCGAAGGTTCGTGAGGAGATAAACCGCCGCTTCAATCCGATTGCTGGGGGCACGGA
TTGGGCAGTGGTAAAAGAGTACTGTGAACAACTGGCCTGTAACCAAGGAATGGATTTTCTGATCTGCGGT
TACTATGCGGTAGCCTGCCTGAAAACTCAGGGGTTAGCGGGGTATGCCACCGGTATGGAGCTGATGAGTG
CAAGCCTTGCCAACCAAGGTGAGTATGATGTGAAAAGCGCCAAAGTGCGCAAAGAGATCCTTGATTGGGT
CAATGCACGTGTGGTGCAGGAACTGAAAGCACTTAAACCAACTTATGAGTCGCTGCGAGATCTGTATCGG
GCTGAGCGCCATTGCGAGCGGTTACATCAGCTGTTTGAACAGCAACAAACCGAATACAAAGTAGACTTCG
AAGGGGTCGGGTTTGCTCTGTTTGAACACATAGACAGAATTGAAACCCAATACCACAGCTTATTGAAAAA
GCAGGAGAAGGCTCAGCCACCTAAGCTTAAGTTTTGGCAGCGCGGTTACGCGTTGTTCACTCTAGGTGTA
CTTGGGGTTGCACTGGGAGTGGTGGGAGGCTACTGGGGGTGGCCTTGGTTTTATACCACGCCTTATGCCG
CGCCACAGCGCATCACCACGTTGAATGAGGCCTCTCAAACTCAAGCACTGCTCAACGACTCTTCCACAAG
TGAGCGTGCGCGTTGGCAACATGATCTGATCCCGCTGTATCGCGATACTTTGCAGCAGAATTTAACCATC
TCGTTTAGTGAACCTAAGCGACATGCCATCACTCAGCTGAATCTATTGCGCACTCTTTATCCTGAAAACG
AGCAAGTGAATGCACTGAGTCAAGAGTTTGCCATTCAGCAGCAACAAGCGTTGGAGCAAACCGCGCTGTT
CGTGGCTAAGTTCAGCGAAATTCGCACCAAAATGGCCAATATCGCGTTACTGGCTAAGCGAGGGAAATGG
GCTGAGTTAGAAAAGCAGACCAAATCATTAGAAGAGTTCGCGGTCAGCCTATCACCGATTTATGGTCGAG
TTGACTATGTGCAAGGCCTACTTGAACAGGGCGATGTCACAAATGCCCAGAAAGAGTTTGCGATCCTCAA
ACAAAGGCTAGATAGCCTAAGTTGGAAAATTGCCGAGCTTGAGCAGCGTATCGGCGATGCGGCTTTGTTG
CAGTGA