SecReT6
Protein ID: 488602370
SecReT6 ID758
T6SS typei4b
Gene symbol-
Locus tagBTI_489
StrainBurkholderia thailandensis MSMB121
Repliconchromosome I [GenBank: NC_021173] [Browse all T6SS(s) in this replicon]
Location [Strand]524814..525428 [-]
Producttype VI secretion lipofamily protein
NoteTssJ
UniProt IDN0AEH0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 3.00E-37, Aligned region: 15..176
Protein Sequence: 204 a.a.     [Download]
>gi|488602370|ref|YP_007917008.1| type VI secretion lipofamily protein [Burkholderia thailandensis MSMB121]
MNPHVTRYALPLAACILLGGCAAAVPLLGSAGSAALQMVGVGKPDVPDSQKPPRNLGLTLYAAQNLNAAN
DNRPLALVVRLYALKDPTSFQQAPFDSFTDPAKEKTALGADLLSVREITLIPGQRYNATEKVSREAQAFG
IVALFRDPALQRWKLTFDPAKSEKSGIIIGLHNCAMTVTGGTVLPSQQGMPAQRLDLLSSVNCG
 
Nucleotide Sequence: 615 bp     [Download]
>gi|488601775|ref|NC_021173.1|:c525428-524814 Burkholderia thailandensis MSMB121 chromosome 1, complete sequence
ATGAATCCGCATGTGACTCGTTACGCGCTGCCGCTCGCCGCCTGCATCCTGCTCGGCGGCTGCGCCGCCG
CCGTGCCGCTCCTCGGTTCGGCGGGCAGCGCCGCGCTGCAGATGGTGGGCGTCGGCAAGCCCGACGTACC
CGATTCGCAGAAGCCGCCGCGCAATCTCGGCCTCACGCTCTATGCGGCGCAGAACCTCAACGCCGCGAAC
GACAACCGTCCGCTCGCGCTCGTCGTGCGCCTCTACGCACTGAAAGACCCGACGTCGTTCCAGCAGGCGC
CGTTCGACAGCTTCACCGATCCGGCGAAAGAGAAGACCGCGCTCGGCGCCGATCTGCTGAGCGTGCGCGA
AATCACGCTGATTCCTGGACAGCGCTACAACGCAACCGAAAAGGTGTCGCGCGAAGCGCAGGCATTCGGC
ATCGTCGCGCTTTTTCGCGACCCGGCGCTACAGCGCTGGAAGCTGACTTTCGATCCTGCGAAGTCCGAGA
AATCCGGCATAATTATCGGCCTGCACAACTGCGCGATGACCGTGACGGGCGGCACCGTCCTGCCTTCGCA
GCAAGGCATGCCGGCGCAGCGGCTCGATTTGCTGTCATCGGTGAATTGCGGGTGA