SecReT6
Protein ID: 488603355
SecReT6 ID758
T6SS typei4b
Gene symbol-
Locus tagBTI_498
StrainBurkholderia thailandensis MSMB121
Repliconchromosome I [GenBank: NC_021173] [Browse all T6SS(s) in this replicon]
Location [Strand]535411..536541 [+]
ProductimpA-related N-terminal family protein
NoteTssA
UniProt IDN0AH97
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 8.80E-24, Aligned region: 55..116
Protein Sequence: 376 a.a.     [Download]
>gi|488603355|ref|YP_007917017.1| impA-related N-terminal family protein [Burkholderia thailandensis MSMB121]
MPINLSELLTPISEASPCGDDLLFSAEFDAIQHARKFDDPSLDQGEWITDIKEADWSFVVEQSSALLRER
TKDLRLAVWLTEALALEDGIGGLTQGYALLTSLCRQFWDHVHPLPDGDDAEYRLGNIAWLAGRTVELLRA
VPLTDGASNAFSELDWDVAQHVAQAIRRDPEQASEIARGKPSVEQIEASKRMTSVAFYARLLGELKTFQA
ALDALEQELGQRAGDAAPSFRQARDAYDTVYRLAERFAKEQGYSADAQPQAVAPNAPGASHERAEPSFKT
PLHSEDPVQRHAHAPSAPAPLVIAGIQNRAQAVEQLRAVAKYFRGTEPHSPVAYLADKAAEWADMPLHQW
LASVVKDDGSLAHIRELLGLKPDDNA
 
Nucleotide Sequence: 1131 bp     [Download]
>gi|488601775|ref|NC_021173.1|:535411-536541 Burkholderia thailandensis MSMB121 chromosome 1, complete sequence
ATGCCGATCAACCTCTCCGAGCTGCTGACGCCGATCAGCGAAGCGTCGCCGTGCGGCGACGATCTCCTCT
TCTCCGCCGAATTCGACGCGATCCAGCACGCGCGCAAGTTCGACGATCCGTCGCTCGACCAGGGCGAGTG
GATCACCGATATCAAGGAAGCGGACTGGAGCTTCGTCGTCGAGCAATCGAGCGCGCTGTTGCGCGAGCGC
ACCAAGGATCTGCGGCTCGCGGTGTGGCTGACCGAGGCGCTCGCGCTCGAGGATGGCATCGGCGGGCTCA
CGCAGGGCTACGCACTGCTCACGAGCCTTTGCCGGCAATTCTGGGATCACGTGCATCCGCTGCCCGACGG
CGACGACGCCGAGTACCGGCTCGGCAACATCGCGTGGCTCGCCGGGCGCACGGTCGAGCTGCTGCGCGCG
GTGCCGCTCACCGACGGCGCGTCGAACGCGTTCAGCGAGCTCGACTGGGACGTCGCGCAGCACGTCGCGC
AGGCGATCCGGCGCGATCCCGAGCAGGCGAGCGAGATCGCGCGCGGCAAGCCGTCGGTCGAGCAGATCGA
GGCGTCGAAGCGGATGACGTCCGTCGCGTTCTATGCGCGGCTGCTCGGCGAGCTGAAAACGTTCCAGGCG
GCGCTCGACGCGCTCGAGCAGGAACTCGGCCAGCGCGCGGGCGACGCGGCGCCGAGCTTTCGGCAGGCGC
GCGACGCGTACGACACCGTCTACCGGCTCGCCGAGCGCTTCGCGAAGGAGCAGGGCTACTCGGCCGACGC
GCAGCCGCAGGCCGTCGCGCCGAATGCGCCGGGGGCGTCGCACGAGCGCGCGGAGCCGAGCTTCAAGACG
CCGCTTCATTCGGAGGACCCCGTGCAGAGACACGCACACGCGCCGTCCGCGCCCGCGCCGCTCGTGATCG
CCGGCATCCAGAATCGTGCGCAGGCGGTCGAGCAGTTGCGCGCGGTCGCGAAGTATTTCCGCGGGACCGA
GCCGCACAGCCCCGTCGCGTACCTCGCCGACAAGGCGGCCGAGTGGGCGGACATGCCGCTGCATCAATGG
CTCGCGTCGGTCGTCAAGGACGACGGCTCGCTCGCGCATATCCGCGAGCTGCTCGGCCTGAAGCCGGACG
ACAACGCGTGA