SecReT6
Protein ID: 488603968
SecReT6 ID758
T6SS typei4b
Gene symbol-
Locus tagBTI_494
StrainBurkholderia thailandensis MSMB121
Repliconchromosome I [GenBank: NC_021173] [Browse all T6SS(s) in this replicon]
Location [Strand]529158..529640 [+]
Productlysozyme family protein
NoteTssE
UniProt IDN0AA26
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.40E-21, Aligned region: 29..137
Protein Sequence: 160 a.a.     [Download]
>gi|488603968|ref|YP_007917013.1| lysozyme family protein [Burkholderia thailandensis MSMB121]
MKRFEPSFLDKLFDDEPHVPAPAAMRQLSLEELKTTVARDVEAILNTRIALTEEHLAALPECRRSVLTYG
LNDFAGLSLASHYDRTFICKSIQQAIARHEPRLQQVSVTFELNEQSTSALYFAIQALLVVHPAEEPVTFD
AMLQPSTLQYSVTRSRAAKV
 
Nucleotide Sequence: 483 bp     [Download]
>gi|488601775|ref|NC_021173.1|:529158-529640 Burkholderia thailandensis MSMB121 chromosome 1, complete sequence
ATGAAACGCTTCGAACCGAGCTTCCTCGACAAGCTGTTCGACGACGAACCGCATGTGCCGGCGCCAGCCG
CGATGCGGCAATTGTCGCTGGAAGAGCTGAAGACCACGGTCGCGCGCGACGTCGAGGCGATCCTCAACAC
GCGCATCGCGCTGACCGAAGAACATCTCGCCGCGCTGCCGGAATGCCGGCGCTCGGTGCTGACCTACGGG
CTGAACGATTTCGCCGGCCTGAGCCTCGCGAGCCACTACGACCGCACGTTCATTTGCAAGTCGATTCAGC
AGGCGATCGCGCGGCACGAGCCGAGGCTGCAGCAGGTGTCGGTGACGTTCGAGCTGAACGAGCAGTCGAC
GAGCGCGCTCTATTTCGCGATCCAGGCGCTGCTCGTCGTGCATCCCGCCGAGGAGCCGGTGACCTTCGAT
GCGATGCTGCAGCCGTCGACGTTGCAATATTCGGTGACGCGTTCGCGCGCCGCCAAGGTGTGA