SecReT6
Protein ID: 488604080
SecReT6 ID758
T6SS typei4b
Gene symbol-
Locus tagBTI_487
StrainBurkholderia thailandensis MSMB121
Repliconchromosome I [GenBank: NC_021173] [Browse all T6SS(s) in this replicon]
Location [Strand]522577..523362 [-]
Producttype IV/VI secretion system, DotU family domain protein
NoteTssL
UniProt IDN0AJA3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 4.70E-57, Aligned region: 31..232
Protein Sequence: 261 a.a.     [Download]
>gi|488604080|ref|YP_007917006.1| type IV/VI secretion system, DotU family domain protein [Burkholderia thailandensis MSMB121]
MSYAPSLFGGNTPPPAPQTVSSTDAGFQARSLVDLLYDGFFMLFLLKNGREPNDASEFGTRIQEFLSEFE
RGAKKLNIAAEDVYAAKFAFCAAIDESVLSSQFKIRADWERRPLQLVLFGEQLAGEKFYQYLEECRAQGA
ARLQSLEVFHMCLLLGFQGKYLLEGPEKLAYLTARLGDEIANMKGKRAPFAPHWPLPDQIAHRLKREVPL
WAIGAVFALVGLLAFVGLNTYLKNSTVRALAPYSQVIKVGPESANLTISLP
 
Nucleotide Sequence: 786 bp     [Download]
>gi|488601775|ref|NC_021173.1|:c523362-522577 Burkholderia thailandensis MSMB121 chromosome 1, complete sequence
ATGAGTTACGCGCCCTCCCTCTTCGGCGGCAACACGCCGCCTCCAGCGCCGCAAACGGTGTCGTCGACCG
ACGCCGGCTTCCAGGCGCGCTCGCTCGTCGATCTGCTGTACGACGGCTTCTTCATGCTGTTCCTGCTGAA
GAACGGCCGCGAGCCGAACGACGCGTCGGAATTCGGCACGCGCATTCAGGAATTCCTGAGCGAATTCGAG
CGCGGCGCGAAGAAACTCAACATCGCCGCCGAGGATGTCTATGCGGCGAAGTTCGCGTTTTGCGCGGCGA
TCGACGAATCGGTGCTGTCGTCGCAATTCAAGATTCGCGCGGACTGGGAACGCCGGCCGCTGCAGCTCGT
GCTGTTCGGCGAACAGCTCGCGGGCGAGAAGTTCTATCAGTACCTCGAAGAATGCCGTGCGCAGGGCGCG
GCGCGACTGCAGTCGCTCGAGGTGTTCCACATGTGCCTGCTGCTCGGCTTCCAGGGCAAGTATCTGCTCG
AAGGGCCGGAGAAGCTTGCGTATCTGACCGCTCGGCTCGGCGACGAGATCGCGAACATGAAAGGCAAGCG
CGCGCCATTCGCACCGCATTGGCCGCTGCCGGATCAGATCGCGCACCGGCTCAAGCGCGAAGTGCCGCTG
TGGGCGATCGGGGCGGTGTTCGCGCTCGTAGGATTGCTTGCGTTCGTCGGGCTCAATACGTATCTGAAAA
ACAGTACCGTGCGGGCGCTTGCGCCTTATTCGCAAGTCATCAAGGTTGGGCCGGAGTCGGCCAATTTGAC
GATTTCGTTGCCTTGA