SecReT6
Protein ID: 488604198
SecReT6 ID758
T6SS typei4b
Gene symbol-
Locus tagBTI_496
StrainBurkholderia thailandensis MSMB121
Repliconchromosome I [GenBank: NC_021173] [Browse all T6SS(s) in this replicon]
Location [Strand]531522..532622 [+]
Producthypothetical protein
NoteTssG
UniProt IDN0AAR7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.30E-93, Aligned region: 18..347
Protein Sequence: 366 a.a.     [Download]
>gi|488604198|ref|YP_007917015.1| hypothetical protein BTI_496 [Burkholderia thailandensis MSMB121]
MQTAQRRIDPGVVERLLDEPHRFEFFQAVRLLETWFAKRHPQRHAARRPGEIVARRIGFRNTLSLGFPPS
EIERAQSYDEAGNALKDDSQRNAAVEAGALSRVELTPAFFGLLGGQGALPLHYTEQIIAREQLKRDHAAR
AFFDVFSNRATALFYSAWKKYRLPLHYELDRDERYLPLLLALAGVSNDDARSTVQQGRGVLLDEAIAGYA
LAARHRPVSAAYLQRTLSEYFCVPIRIEQFVGKWYDVPSDQLSVLGDVNVTLGATALVGERVWQRDMRAR
LVVGPLSKRDYEAFLPGEERAIALERMLTLLAGVTLEYEVSLVLRRTEVGASVLGAGARLGWDAFLCTRE
AERDRADARYELHVIH
 
Nucleotide Sequence: 1101 bp     [Download]
>gi|488601775|ref|NC_021173.1|:531522-532622 Burkholderia thailandensis MSMB121 chromosome 1, complete sequence
ATGCAAACCGCGCAGCGGCGAATCGATCCTGGCGTAGTCGAGCGGCTGCTCGACGAGCCGCATCGCTTCG
AGTTCTTCCAGGCGGTGCGGCTGCTCGAGACCTGGTTCGCGAAGCGCCATCCGCAGCGCCATGCGGCGAG
ACGGCCGGGCGAGATCGTCGCGCGGCGGATCGGCTTTCGCAATACGCTGTCGCTCGGCTTTCCGCCGAGC
GAGATCGAGCGCGCGCAGTCGTACGACGAAGCGGGCAACGCGCTGAAGGACGATTCGCAGCGCAACGCGG
CGGTGGAGGCGGGCGCGCTGTCGCGCGTGGAGCTCACGCCGGCGTTCTTCGGGCTGCTGGGCGGCCAGGG
CGCGCTGCCGCTGCACTACACCGAGCAGATCATCGCGCGCGAGCAGTTGAAGCGCGATCACGCCGCGCGC
GCGTTCTTCGACGTCTTCTCGAACCGCGCGACCGCGCTGTTCTACTCGGCGTGGAAGAAGTACCGGCTGC
CGCTGCATTACGAGCTCGACCGCGACGAGCGCTATCTGCCGCTCTTGCTCGCGCTCGCGGGCGTATCGAA
CGACGATGCGCGCTCGACCGTGCAGCAGGGCCGCGGCGTGCTGCTCGACGAAGCGATCGCCGGCTACGCG
CTCGCCGCGCGGCATCGGCCGGTATCGGCTGCGTATCTGCAGCGCACGCTGTCCGAGTATTTCTGCGTGC
CGATTCGCATCGAGCAGTTCGTCGGCAAGTGGTACGACGTGCCGTCCGATCAACTGAGCGTGCTCGGCGA
CGTGAACGTGACGCTCGGCGCGACGGCGCTCGTCGGCGAACGCGTGTGGCAGCGCGACATGCGCGCGCGG
CTCGTCGTCGGCCCGCTGTCGAAGCGCGACTACGAAGCGTTCCTGCCCGGCGAGGAGCGCGCAATCGCGC
TCGAGCGGATGCTGACGCTGCTCGCCGGCGTGACGCTCGAATACGAGGTGTCGCTCGTGCTGCGCCGCAC
GGAAGTCGGCGCGAGCGTCCTCGGCGCGGGCGCGCGGCTCGGCTGGGATGCGTTCCTCTGCACGCGCGAA
GCCGAGCGCGATCGCGCCGACGCGCGCTACGAGCTGCACGTCATTCATTGA