SecReT6
Protein ID: 488604345
SecReT6 ID758
T6SS typei4b
Gene symbolclpV
Locus tagBTI_497
StrainBurkholderia thailandensis MSMB121
Repliconchromosome I [GenBank: NC_021173] [Browse all T6SS(s) in this replicon]
Location [Strand]532656..535325 [+]
Producttype VI secretion ATPase, ClpV1 family
NoteTssH
UniProt IDN0AK36
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 2.40E-44, Aligned region: 231..328
AAA_2 [PF07724], Evalue: 2.40E-44, Aligned region: 619..787
AAA [PF00004], Evalue: 3.70E-19, Aligned region: 232..345
AAA [PF00004], Evalue: 3.70E-19, Aligned region: 624..760
ClpB_D2-small [PF10431], Evalue: 5.40E-13, Aligned region: 794..865
AAA_5 [PF07728], Evalue: 8.10E-13, Aligned region: 232..252
AAA_5 [PF07728], Evalue: 8.10E-13, Aligned region: 306..362
AAA_5 [PF07728], Evalue: 8.10E-13, Aligned region: 623..742
Clp_N [PF02861], Evalue: 4.30E-12, Aligned region: 27..74
Clp_N [PF02861], Evalue: 4.30E-12, Aligned region: 114..131
AAA_16 [PF13191], Evalue: 2.40E-10, Aligned region: 54..77
AAA_16 [PF13191], Evalue: 2.40E-10, Aligned region: 209..257
AAA_16 [PF13191], Evalue: 2.40E-10, Aligned region: 276..310
AAA_16 [PF13191], Evalue: 2.40E-10, Aligned region: 461..504
AAA_16 [PF13191], Evalue: 2.40E-10, Aligned region: 603..659
AAA_16 [PF13191], Evalue: 2.40E-10, Aligned region: 690..712
AAA_16 [PF13191], Evalue: 2.40E-10, Aligned region: 789..869
AAA_22 [PF13401], Evalue: 1.40E-06, Aligned region: 232..318
AAA_22 [PF13401], Evalue: 1.40E-06, Aligned region: 620..644
AAA_22 [PF13401], Evalue: 1.40E-06, Aligned region: 685..717
Sigma54_activat [PF00158], Evalue: 4.40E-06, Aligned region: 214..248
Sigma54_activat [PF00158], Evalue: 4.40E-06, Aligned region: 621..739
AAA_17 [PF13207], Evalue: 9.90E-05, Aligned region: 68..106
AAA_17 [PF13207], Evalue: 9.90E-05, Aligned region: 233..301
AAA_17 [PF13207], Evalue: 9.90E-05, Aligned region: 477..487
AAA_17 [PF13207], Evalue: 9.90E-05, Aligned region: 623..658
Zeta_toxin [PF06414], Evalue: 0.00014, Aligned region: 128..163
Zeta_toxin [PF06414], Evalue: 0.00014, Aligned region: 231..252
Zeta_toxin [PF06414], Evalue: 0.00014, Aligned region: 613..663
IstB_IS21 [PF01695], Evalue: 0.00017, Aligned region: 223..253
IstB_IS21 [PF01695], Evalue: 0.00017, Aligned region: 623..641
IstB_IS21 [PF01695], Evalue: 0.00017, Aligned region: 798..834
AAA_29 [PF13555], Evalue: 0.00035, Aligned region: 224..248
AAA_29 [PF13555], Evalue: 0.00035, Aligned region: 619..649
AAA_19 [PF13245], Evalue: 0.00039, Aligned region: 230..258
AAA_19 [PF13245], Evalue: 0.00039, Aligned region: 620..645
AAA_14 [PF13173], Evalue: 0.00084, Aligned region: 233..365
AAA_14 [PF13173], Evalue: 0.00084, Aligned region: 622..704
NACHT [PF05729], Evalue: 0.00094, Aligned region: 232..259
NACHT [PF05729], Evalue: 0.00094, Aligned region: 376..463
NACHT [PF05729], Evalue: 0.00094, Aligned region: 624..643
AAA_30 [PF13604], Evalue: 0.00097, Aligned region: 16..40
AAA_30 [PF13604], Evalue: 0.00097, Aligned region: 217..309
AAA_30 [PF13604], Evalue: 0.00097, Aligned region: 619..649
Arch_ATPase [PF01637], Evalue: 0.0012, Aligned region: 211..246
Arch_ATPase [PF01637], Evalue: 0.0012, Aligned region: 284..328
Arch_ATPase [PF01637], Evalue: 0.0012, Aligned region: 621..662
Arch_ATPase [PF01637], Evalue: 0.0012, Aligned region: 694..717
SRP54 [PF00448], Evalue: 0.004, Aligned region: 232..253
SRP54 [PF00448], Evalue: 0.004, Aligned region: 437..508
SRP54 [PF00448], Evalue: 0.004, Aligned region: 622..654
AAA_25 [PF13481], Evalue: 0.0071, Aligned region: 232..255
AAA_25 [PF13481], Evalue: 0.0071, Aligned region: 288..327
AAA_25 [PF13481], Evalue: 0.0071, Aligned region: 443..485
AAA_25 [PF13481], Evalue: 0.0071, Aligned region: 618..641
MobB [PF03205], Evalue: 0.0084, Aligned region: 233..256
MobB [PF03205], Evalue: 0.0084, Aligned region: 622..655
RNA_helicase [PF00910], Evalue: 0.0095, Aligned region: 233..253
RNA_helicase [PF00910], Evalue: 0.0095, Aligned region: 624..645
Protein Sequence: 889 a.a.     [Download]
>gi|488604345|ref|YP_007917016.1| type VI secretion ATPase, ClpV1 family [Burkholderia thailandensis MSMB121]
MSTPLKTLIAKLNPVCRKAAERAASHCFARGHYEVDLEHLFLALLDESTGDVPLVLRASGVDPHALRADL
ERELEGLKTGNTRTPVFSVHLTELFEQAWLIASLDSQIGRIRSGHLLLALLTGPDLAQFAQRMSSQFARV
RVDDLKHKFDEIAAGSAEAEPRQADADGAAPDGAAASGGAPRGPSKTPALDTYTTNLTQRAREGRIDPVI
GRDAEIRQAIDILMRRRQNNPIMTGEAGVGKTAVVEGLALRIAADDVPPPLRGVALHVLDMGLLQAGASV
KGEFENRLKSVIDEVKKSAHPIILFIDEAHTIIGAGGQAGQNDAANLLKPALARGELRTIAATTWSEYKK
YFEKDAALARRFQVVKIEEPSEPLAAAMLRGMAGLMEQHFSVRILDDAITEAVRLSHRYISGRQLPDKAI
SVLDTACAKVALAHSATPAAIDDAKKRIERIDAEIAALEREAASGAVHDERLAELRDAREADLKALADDE
ARYEEERALVTEIGALRAELDAAREPSADGRPADVDATRAKLAERVGALRALQGNRPMVPLQVDGHVVAE
IVASWTGIPLGRMVKDEIETVLNLRDLLGARVIGQDHALDAIAQRVRTATANLEDPNKPRGVFMFVGPSG
VGKTETALALADVLYGGERKMITINMSEYQEAHSVSGLKGSPPGYVGYGEGGVLTEAVRRNPYSVVLLDE
VEKAHPDVLEMFFQVFDKGAMDDAEGREIDFRNTLIILTSNVGSSAVMQVCLNKSPEELPDAETLAETLR
PQLYKTFKPAFLGRMKVIPYYPISDDVLAEIIELKLERIRRRIEANHKAAFEWDESLVDAVLARCTEVDS
GARNVDHILNGTLLPEIAEHVLSRIADGAAIARIAARAAETGEFEYTVE
 
Nucleotide Sequence: 2670 bp     [Download]
>gi|488601775|ref|NC_021173.1|:532656-535325 Burkholderia thailandensis MSMB121 chromosome 1, complete sequence
ATGAGCACGCCCCTGAAGACCCTGATCGCGAAACTGAATCCGGTGTGCCGGAAGGCCGCCGAGCGCGCCG
CCAGCCACTGCTTCGCACGCGGTCACTACGAAGTGGATCTCGAACACCTGTTTCTCGCGCTGCTCGACGA
ATCGACCGGCGACGTGCCCCTCGTGCTGCGCGCGAGCGGCGTCGATCCGCACGCGCTGCGCGCGGATCTC
GAACGCGAGCTCGAAGGACTGAAGACGGGCAACACGCGCACGCCGGTGTTCTCGGTGCATCTGACCGAGC
TGTTCGAGCAGGCGTGGCTCATCGCGTCGCTCGATTCGCAGATCGGCCGGATTCGCTCGGGCCATCTGCT
GCTTGCGCTGCTGACGGGGCCGGATCTCGCGCAGTTCGCGCAGCGGATGTCGTCGCAGTTCGCGCGCGTG
CGCGTCGACGATCTGAAGCACAAGTTCGACGAGATCGCCGCGGGCTCGGCCGAAGCCGAGCCGCGGCAGG
CCGATGCCGACGGGGCGGCGCCGGACGGTGCGGCCGCGTCGGGCGGCGCGCCGCGCGGCCCGTCGAAGAC
GCCGGCGCTCGACACGTACACGACGAACCTCACGCAGCGCGCGCGCGAAGGCAGGATCGACCCGGTGATC
GGCCGCGACGCGGAGATTCGCCAGGCAATCGACATCCTGATGCGCCGCCGGCAGAACAATCCGATCATGA
CGGGCGAGGCGGGCGTCGGCAAGACGGCCGTCGTCGAAGGGCTCGCGCTGCGGATCGCGGCCGACGACGT
GCCGCCGCCGCTTCGCGGCGTCGCGCTGCACGTGCTCGACATGGGCCTCCTGCAGGCGGGCGCGAGCGTG
AAGGGCGAGTTCGAGAATCGCCTGAAGAGCGTGATCGACGAAGTGAAGAAGAGCGCGCATCCGATCATTC
TCTTCATCGACGAAGCGCACACGATCATCGGCGCGGGCGGGCAGGCGGGCCAGAACGACGCGGCGAACCT
GCTGAAGCCGGCGCTCGCGCGCGGCGAGCTGCGCACGATCGCGGCGACGACGTGGAGCGAATACAAGAAG
TACTTCGAAAAGGACGCGGCGCTCGCGCGGCGCTTCCAGGTCGTGAAGATCGAGGAGCCGAGCGAGCCGC
TCGCCGCCGCGATGCTGCGCGGGATGGCGGGGCTGATGGAGCAGCACTTCAGCGTGCGGATTCTCGACGA
CGCGATCACCGAGGCGGTGCGGCTGTCGCATCGCTACATCAGCGGCCGCCAACTGCCGGACAAGGCGATC
AGCGTGCTCGACACCGCGTGCGCGAAGGTCGCGCTCGCGCACAGCGCGACGCCTGCCGCGATCGACGATG
CGAAAAAGCGCATCGAGCGGATCGACGCGGAGATCGCGGCGCTCGAGCGTGAGGCCGCGAGCGGCGCCGT
GCACGATGAGCGCCTCGCCGAGTTGCGCGACGCGCGCGAAGCCGATCTGAAGGCGCTTGCCGACGACGAG
GCGCGCTACGAAGAGGAGCGCGCGCTCGTGACCGAAATCGGCGCGCTGCGCGCCGAGCTCGACGCCGCGC
GCGAGCCGTCCGCCGACGGACGGCCGGCCGACGTCGACGCGACGCGCGCGAAGCTCGCCGAGCGTGTCGG
CGCATTGCGCGCGCTGCAGGGCAACCGGCCGATGGTGCCGCTGCAGGTCGACGGCCATGTCGTCGCGGAA
ATCGTCGCGTCGTGGACGGGCATTCCGCTCGGCCGGATGGTGAAGGACGAGATCGAGACCGTGCTCAATC
TGCGCGATCTGCTCGGCGCGCGCGTGATCGGCCAGGACCACGCGCTCGATGCGATCGCGCAGCGCGTGCG
CACCGCGACCGCGAACCTCGAGGACCCGAACAAGCCGCGCGGCGTGTTCATGTTCGTCGGGCCGTCGGGC
GTCGGCAAGACCGAGACCGCGCTCGCGCTCGCCGACGTGCTGTACGGCGGCGAACGCAAGATGATCACGA
TCAACATGAGCGAGTATCAGGAGGCGCACAGCGTGTCGGGCCTGAAGGGCTCGCCGCCCGGCTACGTCGG
CTACGGCGAGGGCGGCGTGCTGACGGAAGCGGTGCGCCGCAATCCGTATTCGGTCGTGCTGCTCGACGAA
GTCGAGAAGGCGCATCCGGACGTGCTCGAGATGTTCTTCCAGGTGTTCGACAAGGGCGCGATGGACGACG
CCGAAGGCCGCGAGATCGACTTCCGCAATACGCTGATCATCCTGACGTCGAACGTCGGCTCGTCGGCGGT
GATGCAGGTGTGCCTGAACAAGTCGCCGGAAGAGCTGCCCGACGCCGAGACGCTCGCCGAGACGCTGCGC
CCGCAGCTCTACAAGACCTTCAAGCCCGCGTTCCTCGGCCGGATGAAGGTGATTCCGTATTATCCGATCT
CCGACGACGTGCTCGCCGAGATCATCGAGCTGAAGCTCGAACGGATTCGCCGCCGGATCGAAGCGAACCA
CAAGGCCGCGTTCGAATGGGACGAGTCGCTCGTCGACGCCGTGCTCGCGCGCTGCACCGAAGTCGATTCG
GGCGCGCGCAACGTCGATCACATCCTGAACGGCACGCTGCTGCCGGAGATTGCCGAGCACGTGCTGTCGC
GCATCGCCGACGGCGCGGCGATCGCGCGGATCGCCGCGCGCGCGGCCGAGACGGGCGAGTTCGAGTACAC
GGTCGAGTAA