SecReT6
Protein ID: 488604462
SecReT6 ID758
T6SS typei4b
Gene symbol-
Locus tagBTI_492
StrainBurkholderia thailandensis MSMB121
Repliconchromosome I [GenBank: NC_021173] [Browse all T6SS(s) in this replicon]
Location [Strand]527040..528530 [+]
Producthypothetical protein
NoteTssC
UniProt IDN0ADD1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.00E-189, Aligned region: 67..491
Protein Sequence: 496 a.a.     [Download]
>gi|488604462|ref|YP_007917011.1| hypothetical protein BTI_492 [Burkholderia thailandensis MSMB121]
MNQQTAAAQSTGAQVGAQSSLLDEIVEKSKVAKSESEHARAKDLIGELVHQVLDGTVVVSDNLSATIDAR
VAELDRLISSQLSAVMHAAEFQRLESTWRGLDYLVKESNTGSTIKIKALHAPKRDLVRDFKNATEFDQSA
LFKKVYEEEFGTFGGSPFGVLVGDYEISRQPEDLYFVEQMSHVAAAAHAPFVASAAPELLGLESFADLGK
PRDLGKVFDTVEYAKWKSFRDSEDSRYVGLTLPRFLGRLPFNPKDGAIAEGFNFVEDVDGTDHDKYLWCN
ASWAFAARLTAAFDDFGWCAAIRGVEGGGLVEDLPTHTFKTDDGEIALKCPTEIAITDRREKELSDLGFI
PLVHCKNSDYAAFFAAQSVQKPKKYSTDSANANAVLSAQLQYIFSVSRIAHYLKAMMRDKIGSFASAQNV
ETFLNRWISQYVLLDDDATQEQKAQFPLREASVQVSEIPGKPGAYRSVAFLRPHFQLDELSISLRLVADL
PKPANS
 
Nucleotide Sequence: 1491 bp     [Download]
>gi|488601775|ref|NC_021173.1|:527040-528530 Burkholderia thailandensis MSMB121 chromosome 1, complete sequence
ATGAACCAGCAAACGGCTGCGGCCCAATCGACCGGCGCTCAAGTCGGCGCGCAATCCTCGCTGCTCGACG
AGATCGTCGAGAAGAGCAAGGTCGCTAAATCCGAATCCGAGCATGCGCGCGCGAAGGACCTGATCGGCGA
ACTCGTCCATCAGGTGCTCGACGGCACGGTGGTCGTGTCGGACAACCTGTCGGCGACGATCGACGCGCGC
GTCGCGGAGCTCGACCGCCTGATTTCGTCGCAGCTCTCGGCCGTGATGCACGCGGCGGAGTTCCAGCGTC
TCGAAAGCACGTGGCGCGGGCTCGACTATCTGGTGAAGGAAAGCAACACCGGTTCGACGATCAAGATCAA
GGCGCTGCACGCGCCGAAGCGCGATCTCGTGCGCGACTTCAAGAACGCGACCGAGTTCGACCAGAGCGCG
CTCTTCAAGAAGGTCTACGAAGAAGAATTCGGCACGTTCGGCGGCTCGCCGTTCGGCGTGCTGGTGGGCG
ATTACGAGATCTCGCGCCAGCCGGAAGACCTGTACTTCGTCGAGCAGATGTCGCATGTCGCGGCGGCCGC
GCACGCGCCGTTCGTCGCGTCGGCGGCGCCCGAGCTGCTCGGCCTCGAATCGTTCGCCGATCTGGGCAAG
CCGCGCGATCTCGGCAAGGTGTTCGACACCGTCGAATACGCGAAATGGAAGTCGTTCCGCGATTCCGAGG
ATTCGCGCTACGTCGGCCTCACGCTGCCGCGCTTCCTCGGCCGCCTGCCGTTCAATCCGAAGGACGGCGC
GATCGCGGAGGGCTTCAACTTCGTCGAGGACGTCGACGGCACCGATCACGACAAGTACCTGTGGTGCAAT
GCGTCGTGGGCGTTCGCCGCGCGCCTGACGGCCGCGTTCGACGACTTCGGCTGGTGCGCGGCGATTCGCG
GCGTCGAAGGCGGCGGCCTCGTCGAGGATCTGCCGACGCACACGTTCAAGACCGATGACGGCGAAATCGC
GCTCAAGTGCCCGACCGAGATCGCGATCACCGACCGCCGCGAGAAGGAGCTGAGCGACCTCGGCTTCATC
CCGCTCGTGCATTGCAAGAATTCCGATTACGCCGCGTTCTTCGCCGCGCAGTCGGTGCAGAAACCCAAGA
AATACAGCACCGACAGCGCCAATGCGAACGCCGTCCTGTCCGCTCAACTGCAGTACATCTTCTCGGTATC
GCGCATCGCGCATTACCTGAAGGCGATGATGCGCGACAAGATCGGCAGCTTCGCGTCCGCGCAGAACGTC
GAAACGTTCCTCAATCGCTGGATCTCGCAGTACGTGCTGCTCGACGACGACGCGACCCAGGAACAGAAAG
CGCAGTTCCCGCTGCGCGAGGCCTCCGTACAAGTGTCAGAGATTCCGGGCAAGCCGGGTGCGTATCGTTC
GGTCGCGTTCTTGCGTCCGCACTTCCAGCTCGACGAGTTGTCGATTTCTCTGCGCCTTGTCGCTGATCTG
CCCAAACCGGCAAATTCATGA