SecReT6
Protein ID: 488605096
SecReT6 ID758
T6SS typei4b
Gene symbol-
Locus tagBTI_491
StrainBurkholderia thailandensis MSMB121
Repliconchromosome I [GenBank: NC_021173] [Browse all T6SS(s) in this replicon]
Location [Strand]526504..527022 [+]
Producthypothetical protein
NoteTssB
UniProt IDN0AH22
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 5.00E-59, Aligned region: 11..164
Protein Sequence: 172 a.a.     [Download]
>gi|488605096|ref|YP_007917010.1| hypothetical protein BTI_491 [Burkholderia thailandensis MSMB121]
MAKKESIQKRLQKVRPPRVQLTYEVERGDAIEIKELPFVVGVVGDLAGQSEVEQPKLRDRKFVNIDRDNF
DDVMKAIEPRATFQVENRLSEAGGKFAVDLKFRSINDFNPDEVVGQVEPLRRLLEARSKLADLRNKLAGN
DKLEDLLSEVLSNTQQLEALKKSADGGDKQGE
 
Nucleotide Sequence: 519 bp     [Download]
>gi|488601775|ref|NC_021173.1|:526504-527022 Burkholderia thailandensis MSMB121 chromosome 1, complete sequence
ATGGCGAAGAAAGAAAGCATTCAAAAGCGCTTGCAGAAAGTGCGGCCGCCCCGCGTCCAACTGACGTACG
AGGTCGAACGGGGCGATGCGATCGAGATCAAGGAACTGCCGTTCGTCGTCGGAGTCGTCGGCGATCTGGC
GGGGCAATCGGAAGTCGAGCAGCCGAAGCTGCGCGATCGCAAGTTCGTCAACATCGACCGCGACAACTTC
GACGACGTGATGAAGGCGATCGAGCCGCGCGCCACGTTCCAGGTGGAGAACCGCCTGAGCGAGGCGGGCG
GCAAGTTCGCGGTCGATCTGAAGTTCCGCTCGATCAACGATTTCAATCCGGACGAGGTCGTCGGGCAGGT
CGAGCCGTTGCGGCGCCTGCTCGAGGCGCGCTCGAAGCTCGCCGACCTGCGCAACAAGCTGGCCGGCAAC
GACAAGCTCGAAGACCTGCTGAGCGAAGTGCTGTCGAACACGCAGCAGCTCGAAGCGCTGAAGAAGAGCG
CGGACGGCGGCGACAAGCAGGGCGAATGA