SecReT6
Protein ID: 488605200
SecReT6 ID758
T6SS typei4b
Gene symbol-
Locus tagBTI_488
StrainBurkholderia thailandensis MSMB121
Repliconchromosome I [GenBank: NC_021173] [Browse all T6SS(s) in this replicon]
Location [Strand]523359..524705 [-]
Producthypothetical protein
NoteTssK
UniProt IDN0AMF5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 2.90E-135, Aligned region: 19..446
Protein Sequence: 448 a.a.     [Download]
>gi|488605200|ref|YP_007917007.1| hypothetical protein BTI_488 [Burkholderia thailandensis MSMB121]
MSYSAKVLWGEGLFLRPQHFQRQDAYHEARLFESIQAIQPYNWGVRSVRFDRDALGSNVLRASELSLVFP
DGALYSAPQADELPPPIALDTLPEGSNEFTFYLALHPLREAGSNYADNRDAGFVSRFVSEQARVADHFTD
AAEADITFLKTNVKLIAHGEPRDQLLSIPLVRVRRTATSGFEIDDNFVPPCLAIEASPILHQRLRQLIDA
LQAKVNALYGFHREPTKNIIEFRSGDIASFWLLHTASAAFAALAHLHQHSALHPERLFQELLRLAGQLMT
FSKGYVLADLPAYRHDDPGPGFARLDSILRDLLETVISTRYFAITLEEVRPSFHVGRLDSGKIDDKTAFY
LAVSADMPSVELVDAVPARFKVGAPDDVDKLVLSAMPGVRLAYTPQVPPAIPVRPGACYFALDARSPLYE
RMLQAQSAMIYAPSGINDLKFELIAVTS
 
Nucleotide Sequence: 1347 bp     [Download]
>gi|488601775|ref|NC_021173.1|:c524705-523359 Burkholderia thailandensis MSMB121 chromosome 1, complete sequence
ATGAGTTATTCGGCCAAGGTGCTCTGGGGGGAAGGCCTCTTTCTGAGGCCGCAGCACTTTCAGCGGCAGG
ACGCGTACCACGAAGCGCGCCTCTTCGAATCGATTCAGGCGATCCAGCCGTACAACTGGGGCGTGCGCTC
GGTGCGGTTCGACCGCGACGCGCTCGGCAGCAACGTGCTGCGCGCGAGCGAACTGTCGCTCGTGTTCCCG
GACGGCGCGCTCTACTCCGCGCCGCAGGCCGACGAATTGCCGCCGCCCATCGCGCTCGACACGCTGCCCG
AAGGCAGCAACGAATTCACGTTCTACCTCGCATTGCACCCGCTGCGCGAGGCCGGCTCGAACTACGCGGA
TAACCGCGACGCCGGCTTCGTGTCGCGCTTCGTCAGCGAGCAGGCGCGCGTCGCCGATCACTTCACCGAC
GCCGCCGAAGCCGACATCACGTTCCTGAAGACGAACGTGAAGCTGATTGCGCACGGCGAGCCGCGCGACC
AACTGCTGTCGATCCCGCTCGTGCGCGTGCGCCGCACCGCGACGTCCGGCTTCGAGATCGACGACAACTT
CGTGCCGCCGTGCCTCGCGATCGAGGCGTCGCCGATCCTGCATCAGCGCCTGCGGCAACTGATCGACGCG
CTGCAGGCGAAGGTGAACGCGCTATACGGCTTCCATCGCGAGCCGACGAAGAACATCATCGAATTCCGCT
CGGGCGACATCGCATCGTTCTGGCTGCTGCACACGGCGAGCGCCGCGTTCGCCGCGCTCGCGCACCTGCA
TCAGCATTCGGCGCTGCATCCGGAGCGGCTGTTCCAGGAACTGCTGCGCCTCGCCGGCCAACTGATGACG
TTCTCGAAGGGCTATGTGCTCGCCGATCTGCCCGCGTATCGGCACGACGATCCGGGCCCCGGCTTCGCGC
GTCTCGACTCGATCCTGCGCGATCTGCTCGAAACCGTGATCTCGACGCGCTACTTCGCGATCACGCTCGA
GGAAGTGCGGCCGTCGTTCCATGTCGGGCGGCTCGATTCCGGCAAGATCGACGACAAGACCGCGTTCTAT
CTCGCGGTATCGGCCGACATGCCGTCGGTCGAGCTCGTCGATGCCGTGCCCGCGCGCTTCAAGGTGGGCG
CGCCGGACGACGTCGACAAGCTCGTGCTGTCCGCGATGCCGGGCGTGCGCCTTGCGTATACGCCGCAGGT
GCCGCCCGCGATTCCCGTGCGCCCCGGCGCATGCTATTTCGCACTCGATGCGCGCAGCCCGCTCTATGAG
CGGATGCTGCAGGCCCAGTCGGCGATGATCTATGCGCCGTCCGGAATCAATGATCTGAAATTCGAACTGA
TCGCCGTCACGTCATGA