SecReT6
Protein ID: 488605432
SecReT6 ID760
T6SS typei3
Gene symbol-
Locus tagBTI_4630
StrainBurkholderia thailandensis MSMB121
Repliconchromosome II [GenBank: NC_021174] [Browse all T6SS(s) in this replicon]
Location [Strand]1300821..1301324 [+]
Producttype VI secretion lipofamily protein
NoteTssJ
UniProt IDN0AI08
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 2.80E-42, Aligned region: 14..160
Protein Sequence: 167 a.a.     [Download]
>gi|488605432|ref|YP_007921079.1| type VI secretion lipofamily protein [Burkholderia thailandensis MSMB121]
MRPTTIATALAFALACAACASGAARPKEPVRLDLAVNAARTVNPDDRSRPAPIVVSVYELKTDGAFNAAD
FFTLQDKDKTVLADDLLARERFQLRPGERRTIRRNADPAAGALGVVAAYRDLPNSVWRAVYPLPAARDAA
WYRFSSPKLKLTIDLDTHAIRITETGK
 
Nucleotide Sequence: 504 bp     [Download]
>gi|488605303|ref|NC_021174.1|:1300821-1301324 Burkholderia thailandensis MSMB121 chromosome 2, complete sequence
ATGCGTCCGACCACCATCGCTACCGCCCTCGCGTTCGCGCTCGCGTGCGCCGCGTGCGCGAGCGGCGCGG
CCAGGCCGAAGGAGCCGGTGCGGCTCGACCTCGCCGTGAACGCCGCGCGCACAGTCAATCCGGACGACCG
GAGCCGGCCGGCCCCGATCGTCGTGAGCGTCTACGAGCTGAAGACCGACGGCGCGTTCAACGCCGCCGAT
TTCTTCACGCTGCAGGACAAGGACAAGACCGTGCTCGCCGACGATCTGCTCGCGCGCGAGCGCTTCCAGT
TGCGCCCGGGCGAGCGCCGGACGATCCGGCGCAACGCCGATCCGGCGGCGGGCGCGCTCGGCGTCGTCGC
CGCGTACCGCGACCTGCCGAATTCGGTGTGGCGCGCAGTCTATCCGCTGCCGGCCGCGCGGGATGCCGCG
TGGTATCGCTTCTCGTCGCCGAAGCTGAAGCTGACCATCGACCTCGACACGCACGCGATCAGGATCACCG
AAACGGGAAAATGA