SecReT6
Protein ID: 488606292
SecReT6 ID760
T6SS typei3
Gene symbol-
Locus tagBTI_4623
StrainBurkholderia thailandensis MSMB121
Repliconchromosome II [GenBank: NC_021174] [Browse all T6SS(s) in this replicon]
Location [Strand]1293096..1293677 [-]
Productlysozyme family protein
NoteTssE
UniProt IDN0AKM0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.80E-17, Aligned region: 59..170
Protein Sequence: 193 a.a.     [Download]
>gi|488606292|ref|YP_007921072.1| lysozyme family protein [Burkholderia thailandensis MSMB121]
MDEHDKRPAAPRGGHDAPVRGEGVAAPRRANTHLLPTLIDRLRDDAPQRQTEAPGEYAVTRMQMRGIVQR
DLAFLLNTTSIDERIDRERYPAAAASTVNFGMPPLAGAFLASCKWAEIERIVRRVILDFEPRLIAGTLVV
APSKGVDAGERSNVLSFEVRGMIRMDPYPIEFMVQSALDLETSQVNVTGMRAS
 
Nucleotide Sequence: 582 bp     [Download]
>gi|488605303|ref|NC_021174.1|:c1293677-1293096 Burkholderia thailandensis MSMB121 chromosome 2, complete sequence
ATGGACGAGCATGACAAGCGCCCGGCCGCGCCACGCGGCGGCCACGATGCGCCTGTGCGCGGCGAAGGCG
TCGCGGCGCCGCGCCGCGCGAACACGCATCTGCTGCCGACGTTGATCGACCGCCTGCGCGACGACGCGCC
GCAACGCCAGACCGAAGCGCCCGGCGAATACGCGGTCACGCGCATGCAGATGCGCGGCATCGTCCAGCGG
GATCTCGCGTTCCTGCTCAATACGACGAGCATCGACGAGCGCATCGACCGCGAGCGCTACCCGGCCGCCG
CCGCGTCGACCGTCAACTTCGGCATGCCGCCGCTTGCCGGCGCGTTCCTCGCGTCGTGCAAATGGGCCGA
GATCGAACGGATCGTCCGCCGCGTGATTCTCGATTTCGAGCCGCGGCTGATCGCCGGGACGCTCGTCGTC
GCGCCGTCGAAGGGCGTCGACGCGGGCGAGCGCTCGAACGTGCTGTCGTTCGAGGTGCGCGGCATGATTC
GTATGGACCCCTATCCGATCGAATTCATGGTGCAGAGCGCGCTCGATCTCGAAACGAGCCAGGTCAACGT
CACCGGCATGCGCGCGAGCTGA