SecReT6
Protein ID: 488606370
SecReT6 ID760
T6SS typei3
Gene symbol-
Locus tagBTI_4624
StrainBurkholderia thailandensis MSMB121
Repliconchromosome II [GenBank: NC_021174] [Browse all T6SS(s) in this replicon]
Location [Strand]1293664..1294014 [-]
ProductimpE family protein
NoteTagJ
UniProt IDN0ARR7
KEGG IDbtd:BTI_4624
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 7.40E-18, Aligned region: 30..78
Protein Sequence: 116 a.a.     [Download]
>gi|488606370|ref|YP_007921073.1| impE family protein [Burkholderia thailandensis MSMB121]
MTTPISPDSSGARATGRLQDRPLVVGRAPHAPFDWIADSDSRFGPVCEVVTAGHYRWLPLSDPAGWRLAC
PGTLLDLIELDACAFGERAPAGEAMGGATGAAAHRARGGEDSDGRA
 
Nucleotide Sequence: 351 bp     [Download]
>gi|488605303|ref|NC_021174.1|:c1294014-1293664 Burkholderia thailandensis MSMB121 chromosome 2, complete sequence
ATGACGACGCCGATCTCTCCCGATTCGTCCGGCGCACGCGCGACAGGCCGGCTGCAGGACAGGCCGCTCG
TCGTGGGGCGCGCGCCGCATGCGCCGTTCGACTGGATCGCCGACAGCGATTCGCGATTCGGGCCGGTCTG
CGAAGTCGTGACCGCCGGGCATTATCGTTGGCTGCCGCTTTCGGACCCGGCCGGATGGCGGCTCGCGTGC
CCCGGCACGCTGCTCGATCTGATCGAGCTGGACGCGTGCGCATTCGGCGAGCGCGCACCCGCGGGCGAGG
CAATGGGCGGAGCGACAGGCGCCGCGGCGCATCGCGCGCGCGGCGGGGAGGATTCCGATGGACGAGCATG
A