SecReT6
Protein ID: 488606465
SecReT6 ID760
T6SS typei3
Gene symbol-
Locus tagBTI_4622
StrainBurkholderia thailandensis MSMB121
Repliconchromosome II [GenBank: NC_021174] [Browse all T6SS(s) in this replicon]
Location [Strand]1291178..1293067 [-]
Producthypothetical protein
NoteTssF
UniProt IDN0ARZ1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 6.20E-215, Aligned region: 5..626
Protein Sequence: 629 a.a.     [Download]
>gi|488606465|ref|YP_007921071.1| hypothetical protein BTI_4622 [Burkholderia thailandensis MSMB121]
MEPQLLDYYNQELIYMRELAAEFAHAHPKIARRLGMQAGEVADPYVERLIESFCFMAARMQIKLDAEFPR
FTGRLLEVLYPNYVAPTPSMAVARLYPSRTEGNLAEGFRVARGTAFTARVPAGEKTACQFRSGQDVTLYP
LEIADARLTGIPPDIPALDRYVPANVQVRGALRLRLRTTGNVRIADLKGLDRLPLYLAGDPQVASHLFEL
LHVAGVATLTAAPGEFAAPGRPLAAVTVGALAHEGLGVDEGLLPLTWSKFHGHNLLHEYFACPERFYFVA
LTGLEEGLRRIAGQEAEIVVLLDQSPERLADVVDASRFALFCTPVINLFARHTDRIELSTGQTEFHLVPA
RLAPLDYEVFSVEAMYGQVAATSAELEFRPLYQTLNDDESNYGRYFSTRRERRLVSDSARRYGTRTPYVG
TEMFVSLVDQNEAPYSEDIRYLSVDALLTNRDLPSLVPRDGVRDLTVVESAPIDSVGLIRAPSAPKAPYA
EREIAWRLIRQLNFNYLPLDELDHRAGGQGLRGLLRLFLAGDEADNRRQVESLVGVKTRPVTRKLPGAGP
LVFGRGVECALTVDETGFSGVSPYLFGLVLEHYLARHVSINVFTQTELNSIQRGRVARWPVRMGARGGA
 
Nucleotide Sequence: 1890 bp     [Download]
>gi|488605303|ref|NC_021174.1|:c1293067-1291178 Burkholderia thailandensis MSMB121 chromosome 2, complete sequence
GTGGAACCGCAACTGCTCGACTACTACAACCAGGAACTGATCTACATGCGCGAGCTCGCCGCCGAGTTCG
CGCACGCGCACCCGAAGATCGCGCGGCGCCTCGGGATGCAGGCGGGCGAAGTGGCCGATCCGTACGTCGA
GCGGCTGATCGAATCGTTCTGCTTCATGGCCGCGCGCATGCAGATCAAGCTCGACGCGGAATTCCCGCGC
TTCACGGGCCGCCTGCTCGAAGTGCTGTACCCGAACTACGTCGCGCCGACGCCGTCGATGGCAGTCGCGC
GCCTGTACCCGAGCCGCACCGAGGGCAATCTCGCGGAGGGCTTCCGCGTCGCGCGCGGCACCGCGTTCAC
GGCGCGCGTGCCGGCCGGCGAGAAGACCGCGTGCCAGTTCCGCAGCGGCCAGGACGTGACGCTCTATCCG
CTCGAGATCGCCGACGCGCGGCTGACGGGCATTCCGCCCGACATCCCGGCGCTCGACCGCTACGTGCCGG
CCAACGTGCAGGTGCGCGGCGCGCTGCGCCTGCGGCTGCGCACGACCGGCAACGTGCGCATCGCCGATCT
GAAGGGCCTCGACCGGCTGCCGCTGTATCTCGCGGGCGACCCGCAAGTCGCGTCGCACCTGTTCGAGCTG
CTGCACGTGGCCGGCGTCGCGACGCTCACGGCCGCGCCCGGCGAGTTCGCCGCGCCGGGCCGGCCGCTTG
CGGCCGTCACCGTCGGCGCGCTCGCTCACGAAGGGCTCGGCGTCGACGAGGGGCTGCTGCCGCTCACGTG
GTCGAAGTTTCATGGGCACAACCTGCTGCACGAATACTTCGCGTGCCCGGAGCGCTTCTATTTCGTCGCG
CTGACGGGGCTCGAAGAAGGGCTGCGGCGCATCGCCGGCCAGGAGGCCGAGATCGTCGTGCTGCTCGACC
AGTCGCCCGAGCGGCTCGCGGACGTCGTCGACGCGTCGCGCTTCGCGCTGTTCTGCACGCCGGTGATCAA
CCTGTTTGCGCGCCACACGGACCGGATCGAATTGTCAACGGGACAGACCGAGTTCCATCTGGTGCCGGCC
CGCCTCGCGCCGCTCGACTACGAAGTGTTTTCCGTCGAGGCGATGTACGGGCAGGTCGCCGCGACGTCCG
CCGAACTCGAATTCCGGCCGCTGTACCAGACGCTGAACGACGACGAGAGCAACTATGGACGCTATTTCTC
GACGCGGCGCGAGCGCCGGCTCGTGTCGGATTCCGCGCGCCGCTACGGCACGCGCACGCCGTATGTCGGC
ACGGAGATGTTCGTGTCGCTCGTCGACCAGAACGAGGCGCCCTACAGCGAGGACATCCGCTACCTGTCGG
TCGACGCGCTGTTGACGAACCGCGACTTGCCGAGCCTCGTGCCGCGCGACGGCGTGCGCGATCTGACGGT
GGTCGAATCCGCGCCGATCGACAGCGTCGGCCTGATCCGCGCGCCGTCCGCGCCGAAGGCGCCGTATGCG
GAGCGCGAGATCGCGTGGCGGCTGATTCGCCAGTTGAACTTCAACTACCTTCCGCTCGACGAGCTCGACC
ATCGCGCGGGCGGGCAGGGCTTGCGCGGCCTGCTGCGGCTGTTCCTCGCGGGCGACGAGGCCGACAACCG
GCGGCAGGTCGAAAGCCTCGTCGGCGTGAAGACGCGGCCCGTCACGCGCAAGCTGCCCGGCGCGGGCCCG
CTCGTGTTCGGGCGCGGCGTCGAATGCGCGCTGACCGTCGACGAGACGGGATTCTCCGGCGTGAGCCCGT
ATCTGTTCGGCCTCGTGCTCGAGCATTATCTGGCGCGGCACGTGTCGATCAACGTCTTCACGCAGACCGA
GCTGAACTCGATCCAGCGCGGGCGCGTCGCGCGCTGGCCGGTGCGCATGGGCGCGCGGGGAGGCGCGTGA