SecReT6
Protein ID: 488606499
SecReT6 ID760
T6SS typei3
Gene symbol-
Locus tagBTI_4631
StrainBurkholderia thailandensis MSMB121
Repliconchromosome II [GenBank: NC_021174] [Browse all T6SS(s) in this replicon]
Location [Strand]1301346..1302692 [+]
Producthypothetical protein
NoteTssK
UniProt IDN0AH45
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 6.40E-145, Aligned region: 20..447
Protein Sequence: 448 a.a.     [Download]
>gi|488606499|ref|YP_007921080.1| hypothetical protein BTI_4631 [Burkholderia thailandensis MSMB121]
MSWHNKVVWSEGLFMRPQLFQQQERYLEHYAHKRAAPLSPFFFGFSHFSLDSEAPALGKIIVKSASGVFA
DGTPFDAPGSTPPPAPLTIRPEHLDQVIHLAVPIRVPNGEETAFGHAAESLARYAVFETDLRDTNSIGQG
PKTVQLSNLRLRLIPEKELTDAWIGLALTRVKTIRADASIELDDTLIPPVVGYGASDTLASWLAKIHDLT
RLRANALAERLTGADGRAGTTAEVSDYLLLQTLNRYEPLLQHLQRVPTTSPADLYALLIGMAGELSTYVR
TDTRRPLDTHPPYQHVAPHLCLKPVVDDAHRLLNAVLVRSAQSIALADQGHGMLNAVVDPVDMQGFTAVV
LAVHAQMPPDLLQQQFAAQAKAGPSERLPDLVRSHLSGIALQALPVPPRQIPFNAGYVYYELARSGPLWD
EVARHGGLALHIAGEFPSLKLELWGIRG
 
Nucleotide Sequence: 1347 bp     [Download]
>gi|488605303|ref|NC_021174.1|:1301346-1302692 Burkholderia thailandensis MSMB121 chromosome 2, complete sequence
ATGAGCTGGCATAACAAGGTCGTCTGGAGCGAGGGGCTCTTCATGCGCCCGCAGTTGTTCCAGCAGCAGG
AGCGCTACCTCGAGCACTACGCGCACAAGCGCGCGGCGCCGCTGTCGCCGTTCTTCTTCGGCTTCAGCCA
CTTCAGCCTCGACAGCGAGGCGCCGGCGCTCGGCAAGATCATCGTGAAATCGGCGAGCGGCGTGTTCGCC
GACGGCACGCCGTTCGACGCGCCGGGCAGCACGCCGCCGCCCGCGCCGCTCACGATCCGGCCCGAGCACC
TGGACCAGGTGATCCATCTCGCGGTGCCGATCCGCGTGCCGAACGGCGAGGAGACCGCATTCGGCCACGC
GGCCGAATCGCTCGCGCGCTACGCCGTGTTCGAAACCGATCTGCGCGACACGAACTCGATCGGGCAAGGG
CCGAAGACCGTCCAGTTGTCGAACCTGCGCCTGCGGCTGATTCCGGAAAAGGAACTGACGGACGCGTGGA
TCGGGCTCGCGCTCACGCGCGTGAAGACGATCCGCGCGGACGCGAGCATCGAGCTCGACGACACGCTGAT
TCCGCCCGTGGTCGGCTACGGCGCGAGCGACACGCTCGCGAGCTGGCTCGCGAAGATCCACGATCTCACG
CGCCTGCGCGCGAACGCGCTCGCCGAGCGCCTGACGGGCGCGGACGGCCGGGCGGGCACGACGGCCGAAG
TGTCCGACTACCTGCTGCTGCAGACGCTCAATCGCTACGAGCCGCTGCTGCAACACCTGCAGCGCGTGCC
GACGACGTCGCCCGCCGATCTGTACGCGCTCCTCATCGGCATGGCGGGCGAGCTGTCGACCTACGTGCGC
ACCGACACGCGCCGGCCGCTCGATACGCATCCGCCGTATCAGCACGTCGCGCCGCACCTGTGCCTGAAGC
CCGTCGTCGACGATGCGCACCGGCTGCTCAACGCCGTGCTCGTGCGCAGCGCGCAGAGCATCGCGCTCGC
CGATCAGGGGCACGGGATGCTCAATGCGGTCGTCGATCCGGTCGACATGCAGGGCTTCACCGCGGTCGTG
CTCGCGGTGCACGCGCAGATGCCGCCCGATCTGTTGCAGCAGCAGTTCGCCGCGCAGGCGAAGGCGGGGC
CGTCCGAGCGGCTGCCGGACCTCGTGCGCAGCCATCTGTCAGGCATCGCGCTGCAGGCGCTGCCGGTGCC
GCCCCGGCAGATTCCGTTCAACGCCGGCTACGTCTACTACGAGCTCGCGCGAAGCGGACCGCTGTGGGAC
GAAGTGGCGCGGCACGGCGGGCTCGCGTTGCACATCGCCGGCGAATTTCCGTCGCTGAAGCTGGAGCTGT
GGGGCATTCGCGGATAG