SecReT6
Protein ID: 488606832
SecReT6 ID760
T6SS typei3
Gene symbol-
Locus tagBTI_4620
StrainBurkholderia thailandensis MSMB121
Repliconchromosome II [GenBank: NC_021174] [Browse all T6SS(s) in this replicon]
Location [Strand]1288990..1290090 [-]
ProductimpA-related N-terminal family protein
NoteTssA
UniProt IDN0AM29
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.50E-21, Aligned region: 68..128
ImpA-rel_N [PF06812], Evalue: 2.50E-21, Aligned region: 141..148
ImpA-rel_N [PF06812], Evalue: 2.50E-21, Aligned region: 208..220
Protein Sequence: 366 a.a.     [Download]
>gi|488606832|ref|YP_007921069.1| impA-related N-terminal family protein [Burkholderia thailandensis MSMB121]
MTSSRKPAGKAAAARTPKPDDWMAPVDPAAPCGADLEYDPEFVVLSAKAAPRAEAQYGDFVGSPEPVNWS
DVERDCRRLMMRSKDMRLAVLFARSRTRLAGAAGLAEGVGLLAAWLGAFPDAIHPQPDVDADRDAALEIR
RNALQALTDADGLMADVREIALTRSTATRLQVRDVERAFAQPRPGDALAPESVVRQLDDLHAQQPAVLAG
FADALAGLAAIDAWSGEHLGDYAPDLSALEALLRQIAGASADRTAAAPIAPAEADVSPANEAAAMHADEP
PAAQRERAAAEPTAAPVARAAAAAPADRYAARELIRQARQWFEQHEPSSPIPILLRRAEHFVGKRYADVV
QAIPAELLALWSADEA
 
Nucleotide Sequence: 1101 bp     [Download]
>gi|488605303|ref|NC_021174.1|:c1290090-1288990 Burkholderia thailandensis MSMB121 chromosome 2, complete sequence
ATGACCAGCAGCAGAAAACCGGCCGGCAAGGCGGCCGCCGCGCGCACGCCGAAGCCCGACGACTGGATGG
CGCCCGTCGATCCGGCGGCGCCGTGCGGCGCGGACCTTGAATACGATCCCGAGTTCGTCGTGCTGTCGGC
GAAGGCCGCGCCTCGCGCCGAGGCGCAGTACGGGGATTTCGTCGGTTCGCCGGAGCCGGTGAACTGGAGC
GACGTCGAGCGCGATTGCCGGCGGCTGATGATGCGCAGCAAGGACATGCGCCTCGCGGTGCTGTTCGCCC
GGAGCCGGACCCGGCTGGCCGGCGCGGCGGGGCTCGCGGAAGGCGTCGGATTGCTCGCCGCGTGGCTCGG
CGCGTTTCCCGATGCGATTCACCCGCAACCCGACGTCGATGCGGATCGCGACGCGGCGCTGGAGATCCGG
CGCAATGCGCTGCAGGCGCTCACCGATGCCGACGGGCTGATGGCGGACGTGCGCGAGATCGCGCTGACCC
GGTCGACCGCGACGCGCCTGCAGGTGCGCGACGTGGAGCGCGCGTTCGCGCAACCGCGGCCCGGCGATGC
GCTCGCGCCGGAATCGGTCGTGCGTCAGCTCGACGATCTGCACGCGCAGCAGCCGGCGGTCCTGGCGGGC
TTCGCCGATGCGCTCGCGGGGCTGGCCGCGATCGATGCGTGGAGCGGCGAACATCTCGGCGATTACGCAC
CCGACCTGTCGGCGCTCGAAGCGCTGCTTCGCCAGATCGCGGGCGCGAGCGCCGATCGCACGGCCGCCGC
GCCGATCGCGCCGGCCGAGGCCGACGTGTCGCCGGCGAACGAAGCGGCGGCCATGCACGCGGACGAACCG
CCGGCGGCGCAGCGCGAACGCGCGGCGGCGGAGCCGACCGCGGCGCCTGTCGCGCGCGCCGCCGCCGCGG
CGCCGGCGGATCGTTACGCCGCGCGCGAGCTGATCCGGCAGGCGCGCCAGTGGTTCGAGCAGCACGAGCC
GAGCAGCCCGATTCCGATACTGCTCAGGCGTGCGGAGCATTTCGTCGGCAAGCGCTATGCGGACGTGGTA
CAGGCGATCCCCGCCGAGCTGCTCGCGCTATGGAGCGCGGACGAAGCGTGA