SecReT6
Protein ID: 488606906
SecReT6 ID760
T6SS typei3
Gene symbolclpV
Locus tagBTI_4626
StrainBurkholderia thailandensis MSMB121
Repliconchromosome II [GenBank: NC_021174] [Browse all T6SS(s) in this replicon]
Location [Strand]1295264..1297975 [+]
Producttype VI secretion ATPase, ClpV1 family
NoteTssH
UniProt IDN0ARZ7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 3.30E-38, Aligned region: 230..309
AAA_2 [PF07724], Evalue: 3.30E-38, Aligned region: 612..778
AAA [PF00004], Evalue: 1.90E-20, Aligned region: 232..363
AAA [PF00004], Evalue: 1.90E-20, Aligned region: 617..701
AAA_5 [PF07728], Evalue: 5.50E-14, Aligned region: 232..310
AAA_5 [PF07728], Evalue: 5.50E-14, Aligned region: 616..732
ClpB_D2-small [PF10431], Evalue: 6.40E-14, Aligned region: 784..857
AAA_16 [PF13191], Evalue: 3.00E-08, Aligned region: 33..77
AAA_16 [PF13191], Evalue: 3.00E-08, Aligned region: 209..249
AAA_16 [PF13191], Evalue: 3.00E-08, Aligned region: 273..310
AAA_16 [PF13191], Evalue: 3.00E-08, Aligned region: 472..534
AAA_16 [PF13191], Evalue: 3.00E-08, Aligned region: 611..662
Sigma54_activat [PF00158], Evalue: 1.40E-07, Aligned region: 228..312
Sigma54_activat [PF00158], Evalue: 1.40E-07, Aligned region: 616..715
AAA_22 [PF13401], Evalue: 8.80E-07, Aligned region: 232..313
AAA_22 [PF13401], Evalue: 8.80E-07, Aligned region: 615..639
AAA_22 [PF13401], Evalue: 8.80E-07, Aligned region: 678..703
IstB_IS21 [PF01695], Evalue: 2.10E-05, Aligned region: 224..292
IstB_IS21 [PF01695], Evalue: 2.10E-05, Aligned region: 616..636
IstB_IS21 [PF01695], Evalue: 2.10E-05, Aligned region: 686..714
AAA_29 [PF13555], Evalue: 4.10E-05, Aligned region: 224..250
AAA_29 [PF13555], Evalue: 4.10E-05, Aligned region: 614..641
NACHT [PF05729], Evalue: 5.00E-05, Aligned region: 232..260
NACHT [PF05729], Evalue: 5.00E-05, Aligned region: 616..643
AAA_17 [PF13207], Evalue: 7.00E-05, Aligned region: 232..249
AAA_17 [PF13207], Evalue: 7.00E-05, Aligned region: 616..654
AAA_18 [PF13238], Evalue: 8.90E-05, Aligned region: 232..287
AAA_18 [PF13238], Evalue: 8.90E-05, Aligned region: 617..648
Zeta_toxin [PF06414], Evalue: 0.0001, Aligned region: 232..252
Zeta_toxin [PF06414], Evalue: 0.0001, Aligned region: 615..656
AAA_25 [PF13481], Evalue: 0.00021, Aligned region: 232..256
AAA_25 [PF13481], Evalue: 0.00021, Aligned region: 290..325
AAA_25 [PF13481], Evalue: 0.00021, Aligned region: 466..534
AAA_25 [PF13481], Evalue: 0.00021, Aligned region: 614..642
AAA_14 [PF13173], Evalue: 0.00065, Aligned region: 232..312
AAA_14 [PF13173], Evalue: 0.00065, Aligned region: 615..698
AAA_19 [PF13245], Evalue: 0.00068, Aligned region: 230..254
AAA_19 [PF13245], Evalue: 0.00068, Aligned region: 490..490
AAA_19 [PF13245], Evalue: 0.00068, Aligned region: 614..638
AAA_19 [PF13245], Evalue: 0.00068, Aligned region: 890..903
Arch_ATPase [PF01637], Evalue: 0.0063, Aligned region: 210..245
Arch_ATPase [PF01637], Evalue: 0.0063, Aligned region: 283..315
Arch_ATPase [PF01637], Evalue: 0.0063, Aligned region: 615..657
T2SE [PF00437], Evalue: 0.0075, Aligned region: 222..249
T2SE [PF00437], Evalue: 0.0075, Aligned region: 611..693
Hpr_kinase_C [PF07475], Evalue: 0.0099, Aligned region: 232..244
Hpr_kinase_C [PF07475], Evalue: 0.0099, Aligned region: 614..634
Protein Sequence: 903 a.a.     [Download]
>gi|488606906|ref|YP_007921075.1| type VI secretion ATPase, ClpV1 family [Burkholderia thailandensis MSMB121]
MAISRQALFGKLGGTLFRAIESATVFCKLRGNPYVELVHWLQQLLLQADSDLHRIVRHAGIDRDTLDRDI
ARALAALPAGASSISDFSHHVETAIERAWVLATLRFGDRRIRGAWLVAALVDTPELRRVLLSISPTFARI
PQDELDDVLPAWTDGSPEAADAPYDNSGFSPASPGDASGAARAESKGSPLEQYCADLTARARGGDIDPVV
GRELEIRTMIDVLLRRRQNNPLLTGEAGVGKTAVVEGLALAIASGDVPPKLADVRLMSVDVGALLAGASM
KGEFESRLKGVLEAAAKSGAPVILFVDEIHTLIGAGGQAGTGDAANLLKPALARGAIRTIGATTWAEYKR
HIEKDPALTRRFQVLQVPEPEEPAAVHMVRGVARTFSQHHRVTVRDEAIRAAVALSHRYIPSRHLPDKAI
SLLDTACARVALSQHAAPRELQHVRQRLLAARAEHDLLEQEARIGLDAGQSLAAARERIEALVAEEAAVD
ARWKAQADAARALLAAREAALASDGETRAASAPALRELERALATSQGDAPLVFPEVNEAIVAEIVADWTG
IPVGRMVTDEIAAVRALPATLEARVIGQPDALRQIGERVQTARAGLADPKKPLGVFLLAGPSGVGKTETA
LALAEALYGGEQNLITINMSEYQEAHTVSGLKGAPPGYVGYGEGGVLTEAVRRRPYSVVLLDEIEKAHRD
VHELFFQVFDKGYMEDGDGRYIDFRNTTILLTSNAGAELTASLCADASLAPDAAALRDALAPELLKVFPA
AFLGRVSVVPYRPLEPRALARIVRLHLNRVVARMADQHRIALAYDDAVVDYVVGRCLVQETGARLLIGFI
EQHVLPRLSALWLDAISSKAALARIDIGVADPAAPAPQALVFRPGDANRAAAPDAPLTVVQAG
 
Nucleotide Sequence: 2712 bp     [Download]
>gi|488605303|ref|NC_021174.1|:1295264-1297975 Burkholderia thailandensis MSMB121 chromosome 2, complete sequence
ATGGCGATCTCGCGTCAGGCGCTGTTCGGGAAACTCGGGGGCACGCTCTTCAGGGCAATCGAATCGGCTA
CGGTTTTCTGCAAGCTGCGCGGCAATCCGTATGTCGAGCTGGTTCACTGGCTGCAGCAACTGCTGCTGCA
GGCCGACTCTGACCTCCACCGGATCGTGAGGCATGCCGGCATCGACCGCGACACGCTCGATCGCGACATC
GCGCGCGCGCTCGCCGCGCTGCCGGCCGGGGCAAGCTCGATCAGCGATTTCTCCCATCACGTCGAGACCG
CGATCGAGCGCGCGTGGGTGCTCGCGACGCTGCGCTTCGGCGACCGGCGCATCCGCGGCGCGTGGCTCGT
CGCCGCGCTCGTCGATACGCCGGAACTGCGGCGCGTGCTGCTCTCCATTTCGCCGACGTTCGCGAGGATT
CCTCAGGACGAGCTCGACGACGTGCTGCCCGCGTGGACGGACGGCTCCCCGGAAGCGGCGGACGCGCCGT
ACGACAACAGCGGTTTCTCGCCCGCGTCGCCGGGCGACGCGTCCGGTGCGGCGCGCGCCGAGTCGAAGGG
CTCGCCGCTCGAGCAGTACTGCGCGGATCTGACCGCGCGTGCGCGCGGCGGCGACATCGATCCCGTCGTC
GGGCGGGAGCTTGAAATCCGCACGATGATCGACGTGCTGTTGCGGCGCCGACAGAACAATCCGCTGCTCA
CGGGCGAGGCGGGCGTGGGCAAGACGGCGGTCGTCGAGGGCCTCGCGCTCGCGATCGCGAGCGGCGACGT
GCCGCCGAAGCTCGCCGACGTGCGCCTGATGAGCGTCGACGTCGGCGCGCTGCTGGCCGGCGCGAGCATG
AAAGGCGAATTCGAATCGCGGCTGAAAGGCGTGCTCGAGGCCGCCGCGAAATCCGGCGCACCCGTCATCC
TGTTCGTCGACGAGATTCACACGCTGATCGGCGCGGGCGGACAAGCCGGCACGGGCGATGCGGCGAACCT
GCTCAAGCCCGCGCTCGCGCGCGGCGCGATCCGCACGATCGGCGCGACGACGTGGGCCGAGTACAAGCGG
CACATCGAAAAGGACCCCGCGTTGACCCGCCGCTTCCAGGTGTTGCAGGTGCCCGAGCCGGAGGAGCCGG
CCGCGGTCCACATGGTGCGCGGCGTCGCGCGGACGTTCTCGCAGCACCACCGCGTGACGGTTCGCGACGA
AGCGATCCGCGCCGCCGTCGCGCTGTCGCATCGCTACATTCCGTCGCGCCATCTGCCGGACAAGGCGATC
AGCCTCCTCGATACCGCGTGCGCGCGCGTCGCGCTGTCACAGCATGCGGCGCCCCGCGAACTGCAGCACG
TGCGCCAGCGCTTGCTCGCCGCGCGCGCCGAGCACGATCTGCTCGAACAGGAAGCGCGCATCGGCCTCGA
CGCCGGGCAGTCGCTCGCGGCCGCGCGCGAGCGCATCGAGGCGCTCGTGGCCGAAGAAGCGGCCGTCGAC
GCGCGCTGGAAAGCGCAAGCCGACGCGGCGCGCGCGCTGCTCGCCGCGCGCGAGGCCGCGCTAGCCAGCG
ACGGCGAAACGCGCGCCGCGTCCGCCCCCGCGCTGCGCGAGCTCGAACGCGCGCTCGCAACGTCCCAGGG
CGACGCGCCGCTCGTGTTCCCGGAAGTCAACGAGGCGATCGTCGCGGAGATCGTCGCCGACTGGACCGGC
ATCCCGGTCGGCCGCATGGTGACAGACGAAATCGCCGCCGTGCGCGCGCTGCCCGCGACGCTCGAAGCGC
GCGTGATCGGCCAGCCCGACGCGCTGCGCCAGATCGGCGAGCGCGTGCAGACCGCGCGCGCGGGCCTCGC
CGATCCGAAGAAACCGCTCGGCGTGTTCCTGCTCGCGGGCCCGTCGGGCGTCGGCAAGACCGAGACGGCG
CTCGCGCTCGCCGAGGCGCTGTACGGCGGCGAGCAGAACCTGATCACGATCAACATGAGCGAGTATCAGG
AAGCTCATACCGTGTCCGGCCTGAAAGGCGCGCCGCCCGGCTATGTCGGCTACGGCGAGGGCGGCGTGCT
GACCGAGGCCGTGCGGCGGCGGCCGTACAGCGTCGTGCTGCTCGACGAGATCGAGAAGGCGCATCGCGAC
GTGCACGAGCTCTTCTTCCAGGTCTTCGACAAGGGCTACATGGAAGACGGCGACGGCCGCTACATCGATT
TCCGCAACACGACGATCCTGCTCACGAGCAACGCCGGCGCGGAGCTGACCGCGAGCCTGTGCGCCGACGC
ATCGCTCGCGCCCGACGCCGCCGCGCTGCGCGACGCGCTCGCGCCCGAACTGCTGAAGGTCTTTCCGGCC
GCGTTCCTCGGGCGCGTGAGCGTCGTTCCGTACCGGCCGCTCGAACCGCGCGCGCTCGCGCGCATCGTGC
GCCTGCATCTGAATCGCGTCGTCGCGCGCATGGCCGACCAGCACCGGATCGCGCTCGCATACGACGACGC
CGTCGTCGACTACGTCGTCGGGCGCTGCCTCGTGCAGGAAACCGGCGCGCGGCTGCTGATCGGATTCATC
GAGCAGCACGTGTTGCCGCGCCTGTCCGCGCTGTGGCTCGACGCGATTTCGTCGAAAGCGGCGCTCGCGC
GCATCGACATCGGCGTGGCCGATCCGGCCGCGCCGGCACCGCAGGCGCTCGTCTTCCGGCCCGGCGACGC
GAACCGCGCGGCGGCGCCGGACGCGCCGCTTACCGTCGTGCAGGCCGGCTAG