SecReT6
Protein ID: 488606945
SecReT6 ID760
T6SS typei3
Gene symbol-
Locus tagBTI_4619
StrainBurkholderia thailandensis MSMB121
Repliconchromosome II [GenBank: NC_021174] [Browse all T6SS(s) in this replicon]
Location [Strand]1286631..1288919 [-]
ProductRhs element Vgr family protein
NoteTssI
UniProt IDN0AT92
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.20E-83, Aligned region: 35..362
Phage_base_V [PF04717], Evalue: 9.00E-22, Aligned region: 400..493
Protein Sequence: 762 a.a.     [Download]
>gi|488606945|ref|YP_007921068.1| Rhs element Vgr family protein [Burkholderia thailandensis MSMB121]
MPNFPAARTVSVSGPAVPMSPAGEPALELSAIRGNETLSEIYSYTLDCLTPPDPMLTGERAANLDLKAMI
GKALTVTVRLEGMGSFVPGMPGMAGAANIGQGRREISGIVTGARFEGQLNRQCRYRLTMRPWIYLADQRS
DYRIFQNRSVDEIVDEVLNAYSYSYDKRLSGRYPKLGYQVQYGETDFAFIQRLMQEHGIYWFFEHSNKVH
RMVLVDHLGAHKPVESVAYRTLRYYPPGHKIDAEYIDTFGTEERIQPGRWTTDDFDFEKPNADLGVENAL
PRDTAHNGLERYEWPGDYTDREHGEHFARVRMEEVRARGERASGGGNVRDIVCGTTFSLEGCPHASANRE
YLVLGATFTATETGGASGPGEYRINTSFVAQPATTAFRPARTVRKPRTRGPQTAIVTGPRGQDIWTDQYG
RVKLKFHWDRSPVDDQNSSCWVRVSYAWSGNNYGGVNVPRVGSEVIVDFEHGDPDRPLVTGQVYNALHMP
PWRLPENATQSGFMTRSPAGSGENANMLRFEDKAGAEQVKLHAERNYDVSVERDATTTVGRKHLTLVGVD
LMPVMSTRSPLDRLIDLLRTGGAASPASTERQAAARERPLPQQRQPYQQLKQQRQMQRAGGFQALAANVA
MALQQIVAVLTDPFTTASVSTVQGASTSVVFGDAKGVHVGDTVTVTSGNAHSEVNGTASSKDVNSVSLKG
TATSLTGISTSETGASINTTGLYVATNGASVTTTGFSAAETVVQIANKTQECEFIKGIKISM
 
Nucleotide Sequence: 2289 bp     [Download]
>gi|488605303|ref|NC_021174.1|:c1288919-1286631 Burkholderia thailandensis MSMB121 chromosome 2, complete sequence
ATGCCGAATTTTCCCGCCGCCCGTACCGTGTCGGTGAGCGGCCCCGCCGTGCCGATGTCGCCCGCCGGCG
AACCCGCGCTCGAACTGAGCGCGATCCGCGGCAACGAGACGCTGTCGGAGATCTATTCGTACACGCTCGA
TTGCCTCACGCCGCCGGACCCGATGCTCACCGGCGAGCGGGCCGCGAATCTCGATCTGAAGGCGATGATC
GGCAAGGCGCTGACCGTGACCGTCCGGCTCGAAGGCATGGGCTCGTTCGTGCCCGGCATGCCGGGCATGG
CGGGCGCGGCCAACATCGGCCAGGGCAGGCGCGAGATCAGCGGCATCGTGACCGGCGCGCGCTTCGAGGG
CCAGTTGAACCGGCAGTGCCGCTACCGGCTCACGATGCGGCCGTGGATCTATCTGGCCGACCAGCGATCG
GACTACCGGATCTTCCAGAACCGGAGCGTTGACGAGATCGTCGACGAAGTGCTGAACGCGTATTCGTACT
CGTACGACAAGCGCCTGAGCGGCCGGTATCCGAAGCTCGGCTACCAGGTGCAATACGGCGAGACCGATTT
CGCGTTCATCCAGCGGCTGATGCAGGAGCACGGCATCTACTGGTTCTTCGAGCATTCGAACAAGGTGCAC
CGGATGGTGCTTGTCGATCATCTGGGCGCGCACAAGCCGGTGGAGAGCGTTGCGTACCGCACGCTGCGCT
ATTACCCGCCCGGACACAAGATCGACGCCGAATACATCGACACGTTCGGCACCGAGGAGCGCATCCAGCC
GGGCCGCTGGACGACGGACGATTTCGATTTCGAGAAGCCGAACGCGGACCTCGGCGTAGAGAACGCGCTG
CCGCGGGACACCGCGCACAACGGGCTCGAACGTTACGAGTGGCCCGGCGACTACACGGACCGCGAGCACG
GCGAGCACTTCGCGCGCGTGCGGATGGAGGAAGTGCGCGCACGGGGCGAGCGCGCGTCGGGCGGCGGCAA
TGTGCGCGACATCGTGTGCGGCACGACGTTCTCGCTCGAAGGCTGTCCGCACGCGAGCGCGAACCGCGAG
TATCTGGTGCTCGGCGCGACGTTCACGGCGACGGAGACGGGCGGCGCGTCGGGCCCCGGCGAATACCGGA
TCAATACGTCGTTCGTCGCGCAGCCGGCGACCACCGCGTTCCGGCCGGCGCGCACGGTGCGCAAGCCGCG
CACGCGCGGGCCGCAGACGGCGATCGTGACCGGCCCGCGCGGGCAGGACATCTGGACGGACCAGTACGGC
CGCGTGAAGCTGAAGTTCCATTGGGACCGCTCGCCCGTCGACGACCAGAATTCGTCGTGCTGGGTGCGCG
TTTCGTATGCGTGGTCGGGCAACAACTACGGCGGCGTCAACGTTCCGCGCGTGGGCTCGGAAGTGATCGT
CGATTTCGAGCACGGCGATCCGGATCGGCCGCTCGTGACGGGGCAGGTGTATAACGCGCTGCACATGCCG
CCGTGGCGGTTGCCGGAGAACGCGACGCAAAGCGGCTTCATGACGCGCTCGCCGGCCGGCAGCGGCGAGA
ACGCGAACATGCTGCGCTTCGAGGACAAGGCGGGCGCGGAGCAGGTCAAGCTGCACGCGGAGCGCAATTA
CGATGTGTCGGTCGAGCGGGACGCGACGACCACCGTCGGACGCAAGCATCTGACGCTCGTCGGCGTGGAC
CTGATGCCGGTGATGTCGACGCGATCGCCGCTGGATCGGTTGATCGATCTGCTGCGCACGGGCGGCGCGG
CGAGCCCGGCTTCGACGGAGCGGCAGGCGGCCGCCCGCGAGCGCCCGTTGCCGCAACAGCGGCAGCCTTA
TCAGCAATTGAAGCAGCAGCGCCAGATGCAGCGCGCGGGCGGGTTTCAGGCGCTCGCGGCGAACGTGGCG
ATGGCGTTGCAGCAGATCGTCGCGGTGCTCACGGACCCGTTCACGACCGCATCGGTGAGCACCGTGCAGG
GGGCTTCGACGTCGGTCGTGTTCGGCGATGCGAAAGGCGTGCACGTTGGAGACACCGTCACGGTCACGAG
CGGGAATGCGCATTCGGAGGTCAACGGAACGGCGTCGTCGAAAGACGTGAACAGCGTCTCGCTGAAAGGC
ACGGCGACCAGTCTCACGGGAATCAGCACTTCTGAAACCGGTGCGAGCATCAACACGACGGGGCTCTATG
TCGCAACGAACGGCGCGAGCGTGACGACGACCGGATTCAGCGCAGCCGAAACGGTCGTGCAGATCGCCAA
CAAGACGCAGGAATGCGAATTCATCAAGGGCATCAAGATCTCGATGTGA