SecReT6
Protein ID: 488607122
SecReT6 ID760
T6SS typei3
Gene symbol-
Locus tagBTI_4621
StrainBurkholderia thailandensis MSMB121
Repliconchromosome II [GenBank: NC_021174] [Browse all T6SS(s) in this replicon]
Location [Strand]1290087..1291178 [-]
Producthypothetical protein
NoteTssG
UniProt IDN0AMS1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 3.50E-100, Aligned region: 24..325
Protein Sequence: 363 a.a.     [Download]
>gi|488607122|ref|YP_007921070.1| hypothetical protein BTI_4621 [Burkholderia thailandensis MSMB121]
MAHDRTENVVRDAALSPRMLERLRAEPWRYGFLTLLRCIGADARIDPIGKARRPQAEPFRLGQQPSLAFA
PREIASVGDANGRLKVRLFGLGMLGPNGPLPIHVTEIARDREESRRDPTLGNFLDIFHHRYLTLLYRAWA
SAQAAAGLDRPDDERFSFYIASLTGQDVDEIGARPLPAHARLAASPHLVREARNADGLRMTLERYFGVPV
TLEENVFHWIAVDPLEHSHLGKPGDASTMAEGAMLGELVPDRQHKFRLVFGPLDIDAYLRFTPQGEDLPR
LVEWVRAFVGYEFEWELELRIKPNGAPPAVMGGPHQLGWSGWLGRSPSGEPVTGMRFEPEQYADRFARGA
ARPARSRGMRGER
 
Nucleotide Sequence: 1092 bp     [Download]
>gi|488605303|ref|NC_021174.1|:c1291178-1290087 Burkholderia thailandensis MSMB121 chromosome 2, complete sequence
ATGGCGCACGACAGGACGGAGAATGTCGTCCGCGACGCGGCGCTGTCGCCGCGGATGCTCGAACGGCTGC
GCGCCGAGCCGTGGCGCTACGGCTTCCTGACGCTGCTGCGATGCATCGGCGCGGACGCGCGCATCGATCC
GATCGGCAAGGCGCGGCGCCCGCAGGCGGAGCCGTTTCGTCTCGGCCAGCAGCCGAGCCTCGCGTTCGCG
CCGCGCGAGATCGCGAGCGTCGGCGACGCGAACGGGCGCCTCAAGGTGCGGCTGTTCGGGCTCGGGATGC
TGGGGCCGAACGGGCCGCTGCCGATCCACGTGACCGAGATCGCGCGCGACCGCGAGGAGAGCCGGCGCGA
TCCGACGCTCGGCAATTTTCTCGACATCTTCCATCACCGCTATCTGACGCTGCTGTATCGCGCGTGGGCG
TCGGCGCAGGCGGCGGCCGGCCTCGATCGTCCGGATGACGAACGGTTTTCGTTCTACATCGCGAGCCTCA
CCGGCCAGGACGTCGACGAGATCGGCGCGCGGCCGCTGCCCGCGCATGCGCGGCTCGCCGCATCGCCGCA
CCTGGTGCGCGAGGCGCGCAACGCGGACGGCCTGCGGATGACGCTCGAGCGTTACTTCGGCGTGCCGGTG
ACGCTCGAGGAAAACGTATTTCACTGGATTGCCGTCGATCCGCTCGAGCACAGCCATCTCGGCAAGCCGG
GCGATGCGTCGACGATGGCCGAAGGCGCGATGCTCGGCGAGCTGGTGCCGGACCGGCAACACAAGTTCCG
GCTCGTGTTCGGGCCGCTCGACATCGACGCCTACCTGCGCTTCACGCCGCAGGGCGAGGATTTGCCGCGC
CTCGTCGAATGGGTGCGGGCGTTCGTCGGCTACGAGTTCGAATGGGAGCTCGAACTGCGGATCAAGCCGA
ACGGCGCGCCGCCCGCCGTGATGGGCGGCCCGCATCAGCTCGGCTGGTCCGGCTGGCTCGGCCGCTCGCC
GTCCGGCGAGCCAGTGACGGGCATGCGCTTCGAGCCCGAGCAGTATGCGGACCGGTTCGCGCGCGGCGCG
GCCCGGCCCGCCCGATCGCGCGGCATGCGAGGTGAACGATGA