SecReT6
Protein ID: 488607242
SecReT6 ID760
T6SS typei3
Gene symbol-
Locus tagBTI_4632
StrainBurkholderia thailandensis MSMB121
Repliconchromosome II [GenBank: NC_021174] [Browse all T6SS(s) in this replicon]
Location [Strand]1302781..1304055 [+]
Producttype VI secretion system OmpA/MotB family protein
NoteTssL
UniProt IDN0AN65
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.90E-68, Aligned region: 49..259
OmpA [PF00691], Evalue: 5.50E-17, Aligned region: 318..416
Protein Sequence: 424 a.a.     [Download]
>gi|488607242|ref|YP_007921081.1| type VI secretion system OmpA/MotB family protein [Burkholderia thailandensis MSMB121]
MHHPGVSGPQPGPQPSDPAAATFARRDPPPLPAGEPPAARLAAIRLARNPLLEAARPLLRALADMPDRLD
RDDIPQLRLLLEQEVRLFQRLCEQANIRRDHMLGARYCLCTALDEAAMQTSWAKSAGGNLGTWISEGLAT
SFHEDRQGGDKVYLLIGRLMNSPHEHVDLLEVIYRILSLGFEGRYRYEADGQRKHETVRQRLYNEIASQR
GPVSVALSPHWQPGPRSRSAPLRDFPAWITAVVLSLIAFGLFGYFKYALSMRSADVQQRIAAIARMTPPA
APAELRLKALLADEIAAGTVSVDEDARHSSVTFRGDAMFPPGAASVNATMEPLVKKIAAEIAKVPGKVTV
LGYTDNQPIKSRQFASNEALSEERATQVIQMLQSAGVPASRLEALGKGDANPIGDNRTPQGRALNRRVEI
TVAR
 
Nucleotide Sequence: 1275 bp     [Download]
>gi|488605303|ref|NC_021174.1|:1302781-1304055 Burkholderia thailandensis MSMB121 chromosome 2, complete sequence
GTGCATCATCCGGGCGTATCGGGTCCGCAACCGGGTCCGCAGCCGTCCGATCCCGCCGCGGCCACGTTCG
CGCGGCGCGATCCGCCGCCGCTGCCGGCCGGCGAGCCGCCCGCCGCCCGCCTCGCCGCGATCAGGCTCGC
CCGCAATCCGCTGCTCGAAGCGGCGCGCCCGCTGCTGCGGGCGCTCGCCGACATGCCCGACCGGCTCGAT
CGCGACGACATCCCGCAACTGCGCCTGCTGCTCGAACAGGAAGTGCGCCTGTTCCAGCGGCTCTGCGAGC
AGGCGAACATCCGGCGCGACCACATGCTCGGCGCGCGCTACTGCCTGTGCACCGCGCTCGACGAGGCGGC
GATGCAGACGTCATGGGCGAAATCGGCGGGCGGCAATCTCGGCACGTGGATCAGCGAGGGGCTCGCGACG
TCGTTCCACGAGGATCGCCAGGGCGGCGACAAGGTCTACCTGCTGATCGGCCGGCTGATGAATTCGCCGC
ACGAGCACGTCGATCTGCTCGAAGTCATCTATCGCATCCTGAGCCTCGGCTTCGAGGGCCGCTACCGTTA
CGAAGCCGACGGCCAGCGCAAGCACGAGACCGTGCGCCAGCGGCTCTACAACGAGATCGCGTCGCAACGC
GGGCCGGTGTCGGTCGCGCTGTCGCCGCACTGGCAGCCTGGCCCCCGGAGCAGGAGCGCGCCGTTGCGCG
ATTTCCCCGCGTGGATCACCGCCGTCGTGCTGTCGCTGATCGCATTCGGCCTGTTCGGCTACTTCAAGTA
CGCGCTGTCGATGCGCAGCGCCGACGTGCAGCAGCGGATCGCCGCGATCGCGCGGATGACGCCGCCCGCC
GCGCCGGCCGAGCTGCGCCTGAAGGCGCTGCTCGCCGACGAGATCGCGGCGGGCACGGTCAGCGTCGACG
AGGACGCGCGCCACAGCTCGGTGACGTTCCGCGGCGACGCGATGTTTCCGCCGGGCGCGGCCAGCGTGAA
CGCGACGATGGAGCCGCTCGTCAAGAAGATCGCGGCCGAGATCGCGAAAGTGCCGGGCAAGGTGACCGTG
CTCGGCTACACCGACAACCAGCCGATCAAGAGCCGTCAATTCGCGTCGAACGAGGCGCTGTCCGAAGAGC
GCGCGACGCAGGTCATACAGATGCTCCAGAGCGCGGGCGTGCCCGCGAGCCGCCTCGAGGCGCTCGGCAA
GGGCGACGCGAACCCGATCGGCGACAACCGGACCCCGCAGGGCCGCGCGCTGAACCGCCGCGTCGAAATC
ACGGTCGCGCGCTGA