SecReT6
Protein ID: 488607433
SecReT6 ID760
T6SS typei3
Gene symbol-
Locus tagBTI_4627
StrainBurkholderia thailandensis MSMB121
Repliconchromosome II [GenBank: NC_021174] [Browse all T6SS(s) in this replicon]
Location [Strand]1298009..1298590 [+]
Producthypothetical protein
NoteTssB
UniProt IDN0ALS6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 9.40E-59, Aligned region: 11..164
Protein Sequence: 193 a.a.     [Download]
>gi|488607433|ref|YP_007921076.1| hypothetical protein BTI_4627 [Burkholderia thailandensis MSMB121]
MSASSSSQKFIARNRAPRVQIEYDVEVYGSEKKVELPFVMGVLADLSGKPVAPLPAVADRRFLDIDIDNF
DERMKAIKPRVAVAVDNTLSGDGQLMVDMTFESIEDFSPAAIARMVGPLRQLLEARTQLANLQTYMDGKS
GAETLVNRLLQDPALLQSLAAAPKPQLAGGSDAQDTHDAHDAKDAAGRDSDAA
 
Nucleotide Sequence: 582 bp     [Download]
>gi|488605303|ref|NC_021174.1|:1298009-1298590 Burkholderia thailandensis MSMB121 chromosome 2, complete sequence
ATGTCCGCATCCAGCAGCTCTCAAAAATTCATCGCGCGCAATCGCGCGCCCCGCGTGCAGATCGAGTACG
ACGTCGAAGTCTACGGCTCGGAAAAGAAGGTCGAACTGCCGTTCGTGATGGGCGTGCTCGCCGACCTGTC
GGGCAAGCCGGTCGCGCCGCTGCCCGCCGTCGCCGATCGGCGCTTCCTCGACATCGACATCGACAACTTC
GACGAGCGGATGAAGGCGATCAAGCCGCGCGTCGCAGTCGCGGTCGACAACACGCTGTCGGGCGACGGGC
AACTGATGGTCGACATGACGTTCGAAAGCATCGAGGACTTCTCTCCCGCCGCGATCGCGCGGATGGTCGG
GCCGCTGCGCCAGTTGCTCGAGGCGCGCACGCAGCTCGCGAACCTGCAGACCTACATGGACGGCAAGTCG
GGCGCCGAGACGCTCGTCAACCGGTTGCTGCAGGACCCGGCGCTGCTCCAGTCGCTCGCGGCCGCGCCGA
AGCCGCAGCTCGCTGGCGGCTCCGACGCGCAGGACACGCACGACGCGCACGACGCGAAGGACGCGGCGGG
CCGCGACAGCGACGCGGCCTGA