SecReT6
Protein ID: 488607525
SecReT6 ID760
T6SS typei3
Gene symbolhcp1
Locus tagBTI_4629
StrainBurkholderia thailandensis MSMB121
Repliconchromosome II [GenBank: NC_021174] [Browse all T6SS(s) in this replicon]
Location [Strand]1300240..1300725 [+]
Productprotein hcp1
NoteTssD
UniProt IDN0AUQ0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 5.90E-43, Aligned region: 6..136
Protein Sequence: 161 a.a.     [Download]
>gi|488607525|ref|YP_007921078.1| protein hcp1 [Burkholderia thailandensis MSMB121]
MAQDIFLKIDGINGESLDDSHKDEIEVLNWNWEIQQESTMHTGSGGGAGKASVKDLAFEHAIDRASPNLM
KYALTGKHVDQAVLVMRKAGGNPLEYLKLTMSDVIVTRVRPSGSRDDTERSRETVSLSFAKVKQEYVVQN
AQGGSGGAVTTSFDIKGNKEA
 
Nucleotide Sequence: 486 bp     [Download]
>gi|488605303|ref|NC_021174.1|:1300240-1300725 Burkholderia thailandensis MSMB121 chromosome 2, complete sequence
ATGGCGCAGGACATTTTTCTGAAGATCGACGGCATCAACGGCGAATCCCTCGACGACAGTCACAAGGACG
AGATCGAAGTCCTGAACTGGAACTGGGAAATCCAGCAGGAATCGACGATGCACACGGGCAGCGGCGGCGG
CGCCGGCAAGGCGAGCGTCAAGGATCTCGCGTTCGAGCATGCGATCGACCGCGCGAGCCCCAACCTGATG
AAGTACGCGCTGACCGGCAAGCACGTCGACCAGGCGGTGCTCGTGATGCGCAAGGCGGGCGGCAATCCGC
TCGAATACCTGAAGCTCACGATGAGCGACGTGATCGTCACGCGCGTGAGGCCGTCGGGCAGCCGCGACGA
TACCGAGCGCAGCCGCGAGACAGTGTCGCTGTCGTTCGCGAAGGTGAAGCAGGAGTATGTCGTGCAGAAC
GCGCAGGGCGGCAGCGGCGGCGCCGTCACGACGAGCTTCGACATCAAGGGCAACAAGGAAGCCTGA