SecReT6
Protein ID: 488655060
SecReT6 ID763
T6SS typei3
Gene symbol-
Locus tagTY21A_13040
StrainSalmonella enterica subsp. enterica serovar Typhi str. Ty21a
Repliconchromosome [GenBank: NC_021176] [Browse all T6SS(s) in this replicon]
Location [Strand]2645735..2649799 [-]
ProductRhs-family protein
NotePAAR
UniProt IDN0BVX1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam RHS_repeat [PF05593], Evalue: 8.20E-48, Aligned region: 390..425
RHS_repeat [PF05593], Evalue: 8.20E-48, Aligned region: 410..445
RHS_repeat [PF05593], Evalue: 8.20E-48, Aligned region: 483..511
RHS_repeat [PF05593], Evalue: 8.20E-48, Aligned region: 518..555
RHS_repeat [PF05593], Evalue: 8.20E-48, Aligned region: 582..619
RHS_repeat [PF05593], Evalue: 8.20E-48, Aligned region: 624..660
RHS_repeat [PF05593], Evalue: 8.20E-48, Aligned region: 666..696
RHS_repeat [PF05593], Evalue: 8.20E-48, Aligned region: 708..744
RHS_repeat [PF05593], Evalue: 8.20E-48, Aligned region: 751..785
RHS_repeat [PF05593], Evalue: 8.20E-48, Aligned region: 797..826
RHS_repeat [PF05593], Evalue: 8.20E-48, Aligned region: 842..863
RHS_repeat [PF05593], Evalue: 8.20E-48, Aligned region: 848..883
RHS_repeat [PF05593], Evalue: 8.20E-48, Aligned region: 889..920
RHS_repeat [PF05593], Evalue: 8.20E-48, Aligned region: 981..998
RHS_repeat [PF05593], Evalue: 8.20E-48, Aligned region: 989..1017
RHS_repeat [PF05593], Evalue: 8.20E-48, Aligned region: 1033..1051
RHS_repeat [PF05593], Evalue: 8.20E-48, Aligned region: 1056..1089
RHS_repeat [PF05593], Evalue: 8.20E-48, Aligned region: 1118..1126
RHS_repeat [PF05593], Evalue: 8.20E-48, Aligned region: 1143..1165
PAAR_motif [PF05488], Evalue: 9.30E-15, Aligned region: 71..139
AHH [PF14412], Evalue: 4.50E-14, Aligned region: 1240..1335
RHS [PF03527], Evalue: 4.70E-08, Aligned region: 549..566
RHS [PF03527], Evalue: 4.70E-08, Aligned region: 576..594
RHS [PF03527], Evalue: 4.70E-08, Aligned region: 654..662
RHS [PF03527], Evalue: 4.70E-08, Aligned region: 866..884
RHS [PF03527], Evalue: 4.70E-08, Aligned region: 1040..1050
RHS [PF03527], Evalue: 4.70E-08, Aligned region: 1145..1177
Protein Sequence: 1354 a.a.     [Download]
>gi|488655060|ref|YP_007926863.1| Rhs-family protein [Salmonella enterica subsp. enterica serovar Typhi str. Ty21a]
MYEAARVDDPIYHTSALAGFLIGAIIGIAIIALAAFAFFSCGFLAGLILGFMADQIASGVLQLGEAIGRS
IHHTAGKILTGSENVSTNSRPAARAVLSTVKCDNHIAEKRIAQGSGNIYINSQPAARKDDHTECDAVVED
GSPNVFLGGGTQTVLEISSEIPDWLRKVVDVLFVVASLLGGLAGAWRQAAKLGTKFGTKCAAKFIGGELT
GMAVSEAISGLFSNPVDVTTGQKILLPETDFTLPGRLPVTCSRFYASHLETVGLLGQGWRLNWETSLRED
DEHITLTGVQGRELRYPKMMLTPGHQIFGPKEQLYLSRLHDGRYVLHYTDRSYYVFGDFDSDGMAYLLFM
ETPHRQRIVFGHEGGRLVRIASSSGHHLLLHRTQTPAGERLSRIELVQGGTCGNLVEYRYDDNGQLTGVV
NRAGTQVRQFAYENGLMTAHSNAAGFTCRYRWQELDGAPRVTEHDTSDGEHYRFDYDFAAGTTTVTGRQG
ESWQWWYDRETYITAHRTPGGGMYRFTYNEDHFPVNIGLPGGRTVAYEYDIQNRVVKTTDPEGRVTQTQW
NGEFDEITRTALDDDAVWKTQYNAHGQPVQETDPEGRVTQYAYDEQGQMCSRTDAAGGTVVTAFDSRGQM
TRYTDCSGRSTGYDHDEDGNLTRVTDAEGKVVRISYNRLGLPETVNSPGKQQDRYTWNALGLMSSHRRIT
GSVESWRYTPRGLLAAHTDEEKRETRWQYTPEGRVTALTNGNGAQYRFSHDADGRLMREVRPDGLSRTFI
LDDSGYLTAIQTTGTQGGVRRETQQRDALGRLLRTENEHGQRTFSYNRLDQITAVTLTPTEAGQQQHRMQ
ADTVRFEYDRSGWLTAEHAGNGSICYQRDALGNPTDITLPDGQHLTHLYYGSGHLLQTALDGLTVSEYER
DSLHRQIMRTQGQLATYSGYDDDGLLSWQRSLAPGSAPVLPGQRPARQGCVTSRDYYWNNHGEVGTIDDG
LRGSVVYSYDRSGYLTGRSGQMYDHDRYYYDKAGNLLDNEGQGPVMNNRLPGCGRDRYGYNEWGELTTRR
DQQLEWNAQGQLTRVISGNTETHYGYDALGRRIRKATYGRHTGHTARSRTDFVWEGFRLLQENVQQQGWR
TYVYDAEQPYTPVASVTGRGESRQVWYYHTDVTGTPQEVTAADGTLVWAGYIRGFGENAADISNSGAYFH
QPLRLPGQYFDDETGLHYNLFRYYAPECGRFVSQDPIGLRGGLNLYAYCPNPLTWIDPLGLDLHHIIPQE
VWKTFKTDLKKVTGYVQNVTKKAMDVTNLIDLDKPFHGNHPAYSAYVKDKISELIKNKKLSLTELRNLQD
ELRSKINAAKASGKNLNDYFKGGC
 
Nucleotide Sequence: 4065 bp     [Download]
>gi|488652559|ref|NC_021176.1|:c2649799-2645735 Salmonella enterica subsp. enterica serovar Typhi str. Ty21a, complete genome
ATGTATGAAGCAGCCCGTGTGGATGACCCTATCTACCACACCAGTGCGCTCGCCGGGTTTCTTATCGGCG
CTATCATCGGCATCGCCATTATCGCGCTTGCCGCCTTTGCCTTCTTTAGCTGCGGTTTTCTTGCCGGGCT
GATTCTGGGTTTTATGGCCGATCAAATAGCCTCCGGGGTATTGCAACTGGGCGAGGCCATCGGGCGCTCC
ATCCACCACACGGCAGGAAAAATCCTCACCGGTTCGGAGAATGTCAGCACCAACAGTCGCCCGGCGGCGC
GCGCGGTACTGAGTACGGTGAAATGCGATAACCATATCGCAGAAAAACGCATCGCCCAGGGTTCCGGCAA
TATTTACATCAACAGCCAGCCTGCCGCCCGTAAGGATGACCATACCGAATGCGATGCGGTGGTTGAAGAC
GGTTCGCCGAATGTGTTTCTCGGCGGCGGCACACAGACGGTACTGGAAATCAGTTCTGAAATTCCGGACT
GGCTGCGCAAGGTGGTGGATGTATTGTTTGTCGTGGCGAGTCTGCTCGGCGGGCTGGCCGGGGCGTGGCG
GCAGGCGGCAAAGCTGGGGACGAAATTTGGCACTAAATGTGCCGCTAAGTTTATCGGCGGGGAGCTTACC
GGGATGGCCGTGAGTGAGGCTATCAGCGGGCTGTTCAGCAATCCGGTGGATGTGACCACCGGGCAGAAAA
TCCTGCTGCCGGAAACGGACTTCACCCTGCCCGGTCGCCTGCCGGTCACCTGCTCGCGTTTTTACGCCAG
CCACCTGGAAACCGTGGGACTGTTGGGACAGGGCTGGCGGCTGAACTGGGAAACCAGCCTGCGCGAGGAC
GATGAACACATCACGCTGACCGGCGTACAGGGGCGGGAACTGCGTTACCCGAAAATGATGCTGACGCCCG
GCCACCAGATATTTGGCCCGAAAGAACAGTTATACCTCAGCCGCCTGCATGACGGGCGTTACGTGCTGCA
TTACACCGATCGCAGCTATTACGTATTTGGTGATTTTGACAGTGACGGCATGGCATACCTGCTGTTTATG
GAGACGCCGCACCGCCAGCGCATTGTCTTCGGGCACGAAGGAGGCAGACTGGTACGGATAGCCTCCAGCA
GCGGGCATCACCTGTTACTGCACCGCACACAGACCCCGGCAGGGGAGCGGCTGTCGCGAATTGAACTGGT
GCAGGGCGGCACCTGTGGCAATCTGGTGGAGTACCGGTATGACGATAACGGTCAACTGACCGGCGTGGTG
AACCGGGCGGGAACGCAGGTGCGGCAGTTTGCTTATGAAAACGGGCTGATGACGGCGCACAGCAATGCGG
CGGGGTTCACCTGCCGCTACCGCTGGCAGGAACTCGACGGCGCGCCGCGCGTGACGGAGCACGACACCAG
TGACGGTGAACATTACCGCTTTGACTATGATTTTGCCGCAGGCACCACCACCGTCACCGGCAGGCAGGGG
GAGTCATGGCAGTGGTGGTACGACAGGGAGACGTATATCACCGCGCACCGGACGCCGGGCGGTGGAATGT
ACCGCTTCACGTACAACGAAGACCACTTCCCTGTCAACATTGGGCTGCCCGGCGGTCGCACGGTGGCGTA
TGAATATGACATCCAGAACCGGGTGGTGAAGACGACAGATCCGGAAGGCCGGGTGACGCAGACGCAGTGG
AACGGCGAGTTCGACGAAATCACGCGCACGGCGCTGGACGATGACGCTGTCTGGAAAACGCAGTACAACG
CCCACGGCCAGCCAGTGCAGGAGACGGACCCGGAAGGGCGGGTGACGCAGTACGCTTACGATGAACAGGG
GCAGATGTGCAGCCGGACGGATGCGGCGGGCGGCACGGTGGTGACGGCGTTCGACAGCCGGGGGCAGATG
ACGCGGTACACCGACTGTTCAGGGCGTAGCACAGGATATGACCACGATGAGGACGGCAACCTGACGCGGG
TGACGGACGCGGAAGGGAAGGTGGTACGCATCAGCTACAACCGACTTGGGTTGCCGGAGACGGTGAACTC
ACCGGGGAAACAGCAGGACAGGTATACCTGGAATGCGCTGGGGCTGATGAGCAGCCACCGGCGCATCACG
GGGAGCGTGGAGAGCTGGCGGTATACGCCGCGCGGTCTGCTGGCGGCGCACACGGATGAGGAGAAGCGCG
AGACGCGCTGGCAGTACACGCCGGAAGGCCGGGTGACCGCGCTGACCAACGGCAACGGGGCGCAGTACCG
GTTCAGTCACGATGCGGACGGCAGGCTGATGCGTGAGGTGCGCCCGGACGGACTGAGCCGTACTTTTATC
CTGGACGACAGCGGTTATCTGACGGCGATACAGACCACGGGTACGCAGGGCGGCGTGCGGCGGGAGACGC
AGCAGCGGGATGCGCTGGGCCGTCTGTTACGGACGGAGAATGAACACGGCCAGCGGACGTTCAGCTACAA
CCGGCTGGACCAGATAACGGCAGTGACGCTCACGCCCACGGAGGCGGGGCAACAGCAGCACCGGATGCAG
GCCGACACGGTGCGTTTTGAGTATGACCGCAGCGGCTGGCTGACGGCGGAGCACGCGGGGAACGGTAGCA
TATGTTATCAGCGCGACGCGCTGGGCAACCCGACGGACATCACGCTGCCGGACGGGCAGCACCTGACGCA
TCTGTATTACGGGAGCGGGCATCTGTTACAGACGGCGCTGGACGGCCTGACGGTGAGCGAGTATGAGCGC
GACAGCCTGCACCGTCAGATAATGCGCACGCAGGGGCAGCTTGCGACGTACAGCGGCTATGACGACGACG
GGCTGCTGAGCTGGCAGCGCAGCCTGGCGCCCGGCAGTGCCCCTGTTCTTCCCGGCCAGCGCCCGGCGCG
GCAGGGCTGCGTGACGTCGAGGGACTATTACTGGAACAACCACGGCGAGGTGGGCACGATTGACGACGGC
CTGCGTGGCAGCGTGGTGTACAGCTATGACAGAAGCGGTTACCTGACCGGGCGCTCAGGTCAGATGTATG
ACCATGACCGTTATTATTACGATAAGGCGGGCAACCTGCTGGATAACGAAGGGCAGGGTCCGGTGATGAA
CAACCGGCTGCCGGGCTGTGGTCGTGACCGTTACGGTTATAACGAGTGGGGCGAGCTGACCACGCGGCGC
GACCAGCAACTGGAGTGGAACGCGCAGGGGCAGCTGACGCGGGTCATCAGCGGCAACACGGAGACGCACT
ACGGCTACGATGCGCTGGGGAGGCGAATCCGCAAGGCGACGTACGGGCGGCACACGGGCCATACGGCGCG
GAGCCGGACGGACTTTGTGTGGGAGGGGTTCAGGCTGTTGCAGGAGAACGTGCAGCAGCAGGGCTGGCGG
ACATATGTGTACGATGCGGAACAGCCGTACACGCCGGTGGCGAGCGTGACGGGGCGGGGAGAAAGCAGGC
AGGTGTGGTATTACCACACGGACGTGACGGGCACGCCGCAGGAGGTGACGGCGGCGGACGGAACGCTGGT
GTGGGCGGGGTATATCAGGGGGTTTGGAGAGAATGCGGCGGACATCAGCAACAGCGGGGCGTACTTTCAC
CAGCCGCTGCGGCTGCCGGGGCAGTATTTTGACGACGAGACGGGGCTGCATTACAATCTGTTCAGATATT
ATGCACCGGAGTGTGGACGGTTCGTCAGTCAGGATCCGATTGGGTTAAGGGGCGGGTTAAACCTGTATGC
GTACTGCCCTAATCCACTGACATGGATAGATCCTCTGGGACTGGATTTACACCATATAATTCCGCAAGAG
GTTTGGAAAACTTTTAAAACGGATTTAAAAAAAGTCACCGGATATGTGCAAAACGTCACGAAGAAAGCAA
TGGATGTAACAAACTTAATTGATCTGGATAAACCTTTCCATGGTAATCATCCTGCCTATAGTGCTTATGT
AAAAGATAAAATTAGTGAACTTATAAAAAATAAAAAATTAAGTTTAACTGAGCTAAGAAATTTGCAGGAT
GAGTTGAGGTCTAAAATTAATGCTGCAAAAGCATCTGGTAAAAATCTGAATGACTATTTTAAAGGAGGTT
GCTAA