SecReT6
Protein ID: 488655081
SecReT6 ID763
T6SS typei3
Gene symbol-
Locus tagTY21A_13155
StrainSalmonella enterica subsp. enterica serovar Typhi str. Ty21a
Repliconchromosome [GenBank: NC_021176] [Browse all T6SS(s) in this replicon]
Location [Strand]2668402..2671065 [-]
ProductClpB-like protein
NoteTssH
UniProt IDN0C5I4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.20E-39, Aligned region: 235..313
AAA_2 [PF07724], Evalue: 1.20E-39, Aligned region: 609..776
AAA [PF00004], Evalue: 1.20E-18, Aligned region: 236..339
AAA [PF00004], Evalue: 1.20E-18, Aligned region: 381..402
AAA [PF00004], Evalue: 1.20E-18, Aligned region: 615..699
AAA_5 [PF07728], Evalue: 1.10E-12, Aligned region: 236..313
AAA_5 [PF07728], Evalue: 1.10E-12, Aligned region: 614..732
ClpB_D2-small [PF10431], Evalue: 5.40E-12, Aligned region: 785..856
AAA_16 [PF13191], Evalue: 4.00E-11, Aligned region: 213..256
AAA_16 [PF13191], Evalue: 4.00E-11, Aligned region: 277..314
AAA_16 [PF13191], Evalue: 4.00E-11, Aligned region: 383..405
AAA_16 [PF13191], Evalue: 4.00E-11, Aligned region: 474..492
AAA_16 [PF13191], Evalue: 4.00E-11, Aligned region: 605..659
AAA_16 [PF13191], Evalue: 4.00E-11, Aligned region: 678..708
AAA_22 [PF13401], Evalue: 9.20E-08, Aligned region: 236..404
AAA_22 [PF13401], Evalue: 9.20E-08, Aligned region: 613..634
AAA_22 [PF13401], Evalue: 9.20E-08, Aligned region: 676..706
Sigma54_activat [PF00158], Evalue: 3.70E-06, Aligned region: 232..252
Sigma54_activat [PF00158], Evalue: 3.70E-06, Aligned region: 614..714
IstB_IS21 [PF01695], Evalue: 2.10E-05, Aligned region: 220..295
IstB_IS21 [PF01695], Evalue: 2.10E-05, Aligned region: 614..634
NACHT [PF05729], Evalue: 4.90E-05, Aligned region: 236..263
NACHT [PF05729], Evalue: 4.90E-05, Aligned region: 614..644
AAA_25 [PF13481], Evalue: 6.00E-05, Aligned region: 236..311
AAA_25 [PF13481], Evalue: 6.00E-05, Aligned region: 498..530
AAA_25 [PF13481], Evalue: 6.00E-05, Aligned region: 609..640
AAA_25 [PF13481], Evalue: 6.00E-05, Aligned region: 676..697
Zeta_toxin [PF06414], Evalue: 0.00011, Aligned region: 236..256
Zeta_toxin [PF06414], Evalue: 0.00011, Aligned region: 351..404
Zeta_toxin [PF06414], Evalue: 0.00011, Aligned region: 608..664
AAA_19 [PF13245], Evalue: 0.00012, Aligned region: 234..259
AAA_19 [PF13245], Evalue: 0.00012, Aligned region: 386..413
AAA_19 [PF13245], Evalue: 0.00012, Aligned region: 430..456
AAA_19 [PF13245], Evalue: 0.00012, Aligned region: 612..636
AAA_29 [PF13555], Evalue: 0.00037, Aligned region: 226..253
AAA_29 [PF13555], Evalue: 0.00037, Aligned region: 612..639
AAA_14 [PF13173], Evalue: 0.0015, Aligned region: 236..316
AAA_14 [PF13173], Evalue: 0.0015, Aligned region: 382..404
AAA_14 [PF13173], Evalue: 0.0015, Aligned region: 613..696
AAA_17 [PF13207], Evalue: 0.0027, Aligned region: 237..248
AAA_17 [PF13207], Evalue: 0.0027, Aligned region: 614..650
AAA_18 [PF13238], Evalue: 0.0057, Aligned region: 236..249
AAA_18 [PF13238], Evalue: 0.0057, Aligned region: 616..647
RNA_helicase [PF00910], Evalue: 0.006, Aligned region: 189..210
RNA_helicase [PF00910], Evalue: 0.006, Aligned region: 237..257
RNA_helicase [PF00910], Evalue: 0.006, Aligned region: 615..636
Arch_ATPase [PF01637], Evalue: 0.0077, Aligned region: 215..251
Arch_ATPase [PF01637], Evalue: 0.0077, Aligned region: 290..318
Arch_ATPase [PF01637], Evalue: 0.0077, Aligned region: 381..409
Arch_ATPase [PF01637], Evalue: 0.0077, Aligned region: 613..628
Hpr_kinase_C [PF07475], Evalue: 0.0096, Aligned region: 236..247
Hpr_kinase_C [PF07475], Evalue: 0.0096, Aligned region: 612..633
Protein Sequence: 887 a.a.     [Download]
>gi|488655081|ref|YP_007926884.1| ClpB-like protein [Salmonella enterica subsp. enterica serovar Typhi str. Ty21a]
METPVSRSALYGKLAGPLFRSLESATAFCKLRSNPWGELTHWLHQLTQQPDNDILHVLRHYQIPLSDVEK
ALLRQLDMLPAGASAISDFSHHIDLSVEKAWMLASVRYGDNKIRSGWLLLALLTTPELRRVLSSICAPLA
TLPVDELTEILPSLIETSPEAQERPYDGSGLASAIPGESSQAIPNGVQDGKSALAKYCQDMTAQARDGKI
DPVTGREHEIRTMTDILLRRRQNNPLLTGEAGVGKTAVVEGFALAIAQGEVPPALREVRLLALDVGALLA
GASMKGEFESRLKGLLEEAGRSPQPVILFVDEVHTLVGAGGASGTGDAANLLKPALACGTLRTIGATTWS
EYKRHIEKDPALTRRFQVLQIAEPEEIPAMEMVRGLVDTLEKHHNVLILDEAVRAAVQLSHRYIPARQLP
DKAISLLDTAAVRVALTLHTPPASVQFLRQQLKAAEMERSLLQKQEKMGIQSDERCDALTARIFSLNDEL
TASESRWQRELELVHTLQELRVAESDADDKTTLQQAETALREWQGDAPVVFPEVSAAIVAAIVADWTGIP
AGRMVKDEASQVLELPARLAQRVTGQDGALAQIGERIQTARAGLGDPRKPVGVFMLAGPSGVGKTETALA
LAEAIYGGEQNLVTINMSEFQEAHTVSTLKGAPPGYVGYGEGGVLTEAVRRHPWSVVLLDEIEKAHHDVH
ELFYQVFDKGGMEDGEGTHVDFKNTTLLLTTNVGSDLISQMCEDPALMPDATGLKEALMPELRKHFPAAF
LGRVTVIPYLPLDETSRGVIARLHLDRLVARMGEQHGVTLTYSEELVAHIVACCPMHETGARLLIGYIEQ
HILPQLSRYWLQAMTEKAAIRQIDIGVNGDEQIVFETTSQEGICQKS
 
Nucleotide Sequence: 2664 bp     [Download]
>gi|488652559|ref|NC_021176.1|:c2671065-2668402 Salmonella enterica subsp. enterica serovar Typhi str. Ty21a, complete genome
ATGGAAACTCCTGTTTCACGCAGTGCGTTATATGGAAAACTGGCCGGCCCACTATTCCGGTCGCTGGAAT
CGGCAACGGCATTTTGCAAACTACGCTCTAATCCCTGGGGTGAGCTGACTCACTGGCTGCACCAGTTAAC
ACAGCAGCCCGATAACGATATTCTCCACGTTCTTCGGCATTACCAGATCCCTCTTTCTGATGTGGAGAAA
GCGTTACTCCGGCAACTGGATATGCTGCCCGCCGGGGCCAGCGCCATTAGTGATTTTTCTCACCATATCG
ATCTCAGCGTTGAAAAGGCCTGGATGCTGGCGAGCGTCCGTTACGGCGATAACAAAATTCGCAGCGGCTG
GTTGCTGCTGGCCTTGTTGACCACGCCAGAACTGCGTCGGGTACTGAGCAGTATCTGCGCGCCGCTGGCC
ACGCTTCCGGTTGATGAACTGACGGAAATACTGCCCTCGTTGATCGAAACATCGCCGGAAGCGCAGGAGC
GCCCTTACGACGGCTCCGGTCTGGCATCAGCCATTCCCGGTGAAAGCAGCCAGGCGATTCCCAACGGCGT
GCAGGACGGTAAATCCGCGCTGGCAAAATACTGTCAGGACATGACGGCACAGGCGCGCGACGGCAAAATC
GACCCGGTGACGGGGCGTGAGCATGAAATCCGCACCATGACGGATATTCTGCTGCGCCGTCGCCAGAATA
ATCCCCTACTGACTGGTGAGGCGGGCGTCGGAAAGACGGCGGTCGTCGAAGGTTTTGCCCTCGCGATTGC
GCAGGGGGAAGTGCCGCCCGCGCTGCGGGAAGTACGGCTGCTGGCGCTGGACGTTGGCGCTCTGTTGGCC
GGAGCCAGCATGAAAGGCGAGTTTGAATCGCGTCTGAAAGGGTTACTGGAAGAGGCCGGGCGCTCGCCGC
AGCCGGTTATTCTGTTTGTCGATGAAGTTCACACTCTGGTGGGCGCGGGCGGCGCATCCGGCACGGGCGA
TGCCGCTAACCTGCTGAAACCGGCGCTGGCGTGCGGCACCCTGCGGACTATCGGCGCCACCACCTGGAGC
GAATACAAGCGCCATATTGAGAAAGATCCGGCGCTGACCCGTCGTTTTCAGGTGTTGCAGATTGCCGAGC
CGGAAGAGATCCCCGCAATGGAAATGGTGCGTGGTCTGGTGGATACGCTGGAAAAACACCATAACGTACT
GATTCTGGATGAGGCGGTACGTGCGGCGGTACAGCTTTCTCACCGCTACATTCCCGCCCGGCAGTTGCCG
GATAAGGCCATCAGCCTACTGGATACCGCCGCGGTCCGCGTGGCGCTGACGCTGCACACGCCGCCTGCCA
GCGTACAGTTCCTGCGTCAGCAGCTAAAAGCGGCGGAAATGGAACGGTCGCTGTTGCAGAAGCAGGAAAA
AATGGGGATTCAGTCAGATGAGCGGTGCGATGCGCTGACGGCGCGAATTTTCTCGCTCAACGATGAACTG
ACTGCATCCGAATCCCGCTGGCAGCGGGAGCTGGAACTGGTACATACGTTGCAGGAACTGCGTGTCGCAG
AGTCTGATGCTGATGACAAAACCACGCTGCAACAGGCCGAAACAGCGCTAAGGGAGTGGCAGGGCGACGC
GCCGGTGGTGTTCCCGGAAGTCAGCGCGGCGATTGTCGCGGCGATTGTCGCCGACTGGACCGGTATTCCT
GCCGGGCGCATGGTGAAAGATGAGGCCAGCCAGGTGCTGGAACTGCCTGCCCGACTGGCGCAACGCGTTA
CCGGGCAAGACGGCGCGCTGGCGCAGATTGGTGAACGTATTCAGACCGCCAGGGCGGGACTGGGCGATCC
ACGCAAACCGGTGGGCGTGTTTATGCTGGCCGGGCCGTCCGGTGTCGGTAAAACCGAAACCGCGCTGGCG
CTGGCGGAGGCTATCTACGGCGGTGAGCAGAACCTGGTAACCATCAATATGAGCGAGTTCCAGGAGGCTC
ACACCGTTTCCACACTGAAAGGCGCGCCGCCCGGCTATGTGGGCTATGGCGAGGGTGGTGTGCTGACGGA
AGCGGTGCGTCGTCACCCCTGGAGCGTAGTGCTGCTCGACGAGATCGAAAAAGCGCACCATGACGTCCAT
GAACTCTTCTATCAGGTGTTTGACAAGGGCGGGATGGAGGACGGTGAGGGAACACATGTCGATTTCAAAA
ACACCACGCTACTACTCACCACCAATGTAGGTTCCGACCTCATCAGCCAGATGTGTGAAGATCCGGCCTT
AATGCCCGATGCTACGGGGCTTAAAGAGGCGCTAATGCCGGAATTGCGCAAGCATTTCCCGGCGGCATTT
CTGGGCCGCGTGACGGTGATCCCTTACCTGCCGCTGGATGAAACGTCGCGTGGCGTGATTGCCCGTCTGC
ATCTTGACCGGCTGGTGGCGCGGATGGGTGAACAGCACGGGGTGACGCTGACGTATAGTGAGGAACTGGT
CGCACATATTGTGGCGTGCTGTCCAATGCATGAAACGGGCGCGCGGTTGCTGATTGGCTACATCGAACAG
CACATCCTGCCACAACTGTCGCGCTACTGGTTGCAGGCCATGACGGAAAAAGCCGCTATCAGGCAGATTG
ATATCGGCGTTAATGGTGATGAGCAGATTGTTTTTGAGACAACCTCGCAGGAGGGAATATGCCAAAAGAG
TTAA

Protein ID: 488655097
SecReT6 ID763
T6SS typei3
Gene symbol-
Locus tagTY21A_13245
StrainSalmonella enterica subsp. enterica serovar Typhi str. Ty21a
Repliconchromosome [GenBank: NC_021176] [Browse all T6SS(s) in this replicon]
Location [Strand]2693220..2695793 [-]
Productprotein disaggregation chaperone
NoteTssH
UniProt IDN0C4L9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 6.00E-58, Aligned region: 202..280
AAA_2 [PF07724], Evalue: 6.00E-58, Aligned region: 596..760
ClpB_D2-small [PF10431], Evalue: 3.20E-28, Aligned region: 766..845
AAA [PF00004], Evalue: 5.60E-28, Aligned region: 203..337
AAA [PF00004], Evalue: 5.60E-28, Aligned region: 431..453
AAA [PF00004], Evalue: 5.60E-28, Aligned region: 602..728
Clp_N [PF02861], Evalue: 7.10E-28, Aligned region: 17..68
Clp_N [PF02861], Evalue: 7.10E-28, Aligned region: 94..145
AAA_5 [PF07728], Evalue: 6.60E-20, Aligned region: 203..228
AAA_5 [PF07728], Evalue: 6.60E-20, Aligned region: 431..466
AAA_5 [PF07728], Evalue: 6.60E-20, Aligned region: 601..721
AAA_5 [PF07728], Evalue: 6.60E-20, Aligned region: 730..761
AAA_16 [PF13191], Evalue: 1.90E-15, Aligned region: 180..223
AAA_16 [PF13191], Evalue: 1.90E-15, Aligned region: 245..288
AAA_16 [PF13191], Evalue: 1.90E-15, Aligned region: 435..477
AAA_16 [PF13191], Evalue: 1.90E-15, Aligned region: 571..637
AAA_16 [PF13191], Evalue: 1.90E-15, Aligned region: 667..695
Sigma54_activat [PF00158], Evalue: 7.10E-10, Aligned region: 181..221
Sigma54_activat [PF00158], Evalue: 7.10E-10, Aligned region: 599..738
AAA_22 [PF13401], Evalue: 6.30E-09, Aligned region: 199..283
AAA_22 [PF13401], Evalue: 6.30E-09, Aligned region: 324..419
AAA_22 [PF13401], Evalue: 6.30E-09, Aligned region: 599..695
AAA_18 [PF13238], Evalue: 1.40E-07, Aligned region: 204..272
AAA_18 [PF13238], Evalue: 1.40E-07, Aligned region: 603..620
AAA_18 [PF13238], Evalue: 1.40E-07, Aligned region: 779..794
AAA_17 [PF13207], Evalue: 1.40E-07, Aligned region: 204..280
AAA_17 [PF13207], Evalue: 1.40E-07, Aligned region: 605..659
AAA_17 [PF13207], Evalue: 1.40E-07, Aligned region: 784..832
IstB_IS21 [PF01695], Evalue: 1.10E-06, Aligned region: 197..260
IstB_IS21 [PF01695], Evalue: 1.10E-06, Aligned region: 501..528
IstB_IS21 [PF01695], Evalue: 1.10E-06, Aligned region: 601..621
RuvB_N [PF05496], Evalue: 3.80E-05, Aligned region: 203..283
RuvB_N [PF05496], Evalue: 3.80E-05, Aligned region: 328..378
RuvB_N [PF05496], Evalue: 3.80E-05, Aligned region: 565..622
RuvB_N [PF05496], Evalue: 3.80E-05, Aligned region: 671..699
AAA_28 [PF13521], Evalue: 7.30E-05, Aligned region: 203..341
AAA_28 [PF13521], Evalue: 7.30E-05, Aligned region: 601..620
Zeta_toxin [PF06414], Evalue: 0.0001, Aligned region: 198..223
Zeta_toxin [PF06414], Evalue: 0.0001, Aligned region: 316..332
Zeta_toxin [PF06414], Evalue: 0.0001, Aligned region: 601..653
Zeta_toxin [PF06414], Evalue: 0.0001, Aligned region: 780..795
AAA_25 [PF13481], Evalue: 0.00012, Aligned region: 203..276
AAA_25 [PF13481], Evalue: 0.00012, Aligned region: 436..488
AAA_25 [PF13481], Evalue: 0.00012, Aligned region: 597..620
Arch_ATPase [PF01637], Evalue: 0.00013, Aligned region: 182..222
Arch_ATPase [PF01637], Evalue: 0.00013, Aligned region: 254..287
Arch_ATPase [PF01637], Evalue: 0.00013, Aligned region: 434..434
Arch_ATPase [PF01637], Evalue: 0.00013, Aligned region: 603..626
Arch_ATPase [PF01637], Evalue: 0.00013, Aligned region: 668..683
Arch_ATPase [PF01637], Evalue: 0.00013, Aligned region: 770..806
RNA_helicase [PF00910], Evalue: 0.00034, Aligned region: 204..224
RNA_helicase [PF00910], Evalue: 0.00034, Aligned region: 602..623
RNA_helicase [PF00910], Evalue: 0.00034, Aligned region: 708..720
Bac_DnaA [PF00308], Evalue: 0.00054, Aligned region: 198..224
Bac_DnaA [PF00308], Evalue: 0.00054, Aligned region: 397..456
Bac_DnaA [PF00308], Evalue: 0.00054, Aligned region: 596..627
AAA_19 [PF13245], Evalue: 0.00073, Aligned region: 199..239
AAA_19 [PF13245], Evalue: 0.00073, Aligned region: 604..623
NACHT [PF05729], Evalue: 0.001, Aligned region: 203..231
NACHT [PF05729], Evalue: 0.001, Aligned region: 603..621
Mg_chelatase [PF01078], Evalue: 0.001, Aligned region: 198..221
Mg_chelatase [PF01078], Evalue: 0.001, Aligned region: 600..628
Mg_chelatase [PF01078], Evalue: 0.001, Aligned region: 672..700
AAA_3 [PF07726], Evalue: 0.0014, Aligned region: 204..223
AAA_3 [PF07726], Evalue: 0.0014, Aligned region: 671..719
DUF815 [PF05673], Evalue: 0.0016, Aligned region: 187..227
DUF815 [PF05673], Evalue: 0.0016, Aligned region: 442..470
DUF815 [PF05673], Evalue: 0.0016, Aligned region: 600..640
DUF258 [PF03193], Evalue: 0.0022, Aligned region: 192..222
DUF258 [PF03193], Evalue: 0.0022, Aligned region: 602..620
ResIII [PF04851], Evalue: 0.0024, Aligned region: 185..224
ResIII [PF04851], Evalue: 0.0024, Aligned region: 267..288
ResIII [PF04851], Evalue: 0.0024, Aligned region: 573..617
ResIII [PF04851], Evalue: 0.0024, Aligned region: 755..790
T2SE [PF00437], Evalue: 0.0036, Aligned region: 192..222
T2SE [PF00437], Evalue: 0.0036, Aligned region: 591..679
ABC_tran [PF00005], Evalue: 0.0038, Aligned region: 203..224
ABC_tran [PF00005], Evalue: 0.0038, Aligned region: 425..479
ABC_tran [PF00005], Evalue: 0.0038, Aligned region: 603..624
MobB [PF03205], Evalue: 0.0042, Aligned region: 204..225
MobB [PF03205], Evalue: 0.0042, Aligned region: 602..624
AAA_29 [PF13555], Evalue: 0.0087, Aligned region: 197..219
AAA_29 [PF13555], Evalue: 0.0087, Aligned region: 600..622
Protein Sequence: 857 a.a.     [Download]
>gi|488655097|ref|YP_007926900.1| protein disaggregation chaperone [Salmonella enterica subsp. enterica serovar Typhi str. Ty21a]
MRLDRLTNKFQLALADAQSLALGHDNQFIEPLHLMSALLNQEGGSIRPLLTSAGINAGQLRTAIDQALSR
LPQVEGTGGDVQPSSELVRVLNLCDKLAQKRGDNFISSELFVLAALESRGTLTDLLKSAGATTANITQAI
EQMRGGESVNDQGAEDQRQALKKYTVDLTERAEQGKLDPVIGRDEEIRRTIQVLQRRTKNNPVLIGEPGV
GKTAIVEGLAQRIINGEVPEGLKGRRVLALDMGALVAGAKYRGEFEERLKGVLNDLAKQEGNVILFIDEL
HTMVGAGKADGAMDAGNMLKPALARGELHCVGATTLDEYRQYIEKDAALERRFQKVFVAEPSVEDTIAIL
RGLKERYELHHHVQITDPAIVAAATLSHRYIADRQLPDKAIDLIDEAASSIRMQIDSKPEELDRLDRRII
QLKLEQQALMKESDEASKKRLDMLNEELDDKERQYSELEEEWKAEKASLSGTQTIKAELEQAKIAIEQAR
RVGDLARMSELQYGKIPELEKQLEAATQSEGKTMRLLRNKVTDAEIAEVLARWTGIPVSRMLEGEREKLL
RMEQELHSRVIGQNEAVEAVSNAIRRSRAGLSDPNRPIGSFLFLGPTGVGKTELCKALANFMFDSDDAMV
RIDMSEFMEKHSVSRLVGAPPGYVGYEEGGYLTEAVRRRPYSVILLDEVEKAHPDVFNILLQVLDDGRLT
DGQGRTVDFRNTVVIMTSNLGSDLIQERFGELDYGRMKEMVLGVVSQNFRPEFINRIDEVVVFHPLGEQH
IASIAQIQLQRLYKRLEERGYEIHISDEALKLLSANGYDPVYGARPLKRAIQQQIENPLAQQILSGELVP
GKVIRLEANDDRIVAVQ
 
Nucleotide Sequence: 2574 bp     [Download]
>gi|488652559|ref|NC_021176.1|:c2695793-2693220 Salmonella enterica subsp. enterica serovar Typhi str. Ty21a, complete genome
ATGCGTCTGGATCGTCTTACTAACAAATTCCAGCTTGCTCTTGCCGATGCCCAGTCGCTCGCGCTGGGGC
ACGACAACCAATTCATCGAACCTCTTCATTTAATGAGCGCCTTGCTGAACCAGGAAGGGGGATCGATACG
TCCTTTATTAACCTCCGCCGGCATTAATGCTGGCCAGTTGCGCACTGCTATCGATCAGGCGCTGAGCCGT
TTACCGCAGGTGGAAGGCACCGGCGGCGACGTACAGCCTTCTTCGGAACTGGTACGCGTACTGAACCTTT
GCGACAAGCTGGCGCAAAAACGGGGGGACAATTTTATTTCGTCAGAGCTGTTTGTTCTGGCGGCGCTTGA
GTCTCGCGGCACGTTAACCGATCTGCTGAAATCAGCCGGTGCGACTACGGCCAATATCACTCAGGCAATT
GAACAGATGCGCGGAGGTGAAAGCGTGAACGATCAAGGGGCTGAAGACCAACGTCAGGCCTTGAAAAAAT
ATACCGTCGATCTGACCGAGCGGGCTGAACAAGGTAAGCTTGACCCGGTAATTGGTCGTGATGAAGAAAT
TCGCCGTACCATTCAGGTATTGCAACGTCGTACTAAAAACAACCCGGTGTTAATCGGTGAGCCAGGCGTA
GGTAAAACCGCCATTGTTGAAGGGCTGGCGCAACGTATTATCAACGGTGAAGTACCGGAAGGCCTGAAAG
GCCGTCGCGTGCTGGCGCTGGATATGGGCGCGCTGGTGGCCGGGGCGAAATATCGCGGCGAATTTGAAGA
GCGTCTGAAAGGCGTGCTGAACGACCTCGCAAAACAGGAAGGCAACGTCATCCTGTTTATCGACGAGCTG
CACACCATGGTTGGCGCAGGTAAAGCTGATGGCGCCATGGATGCCGGTAACATGCTGAAACCGGCGCTGG
CACGTGGGGAACTGCACTGTGTGGGCGCCACCACGCTGGACGAATATCGTCAGTACATCGAAAAAGACGC
GGCGCTGGAACGTCGATTCCAGAAAGTGTTCGTGGCAGAGCCGTCGGTGGAAGACACCATTGCGATTTTG
CGTGGTCTGAAAGAGCGTTATGAACTGCATCACCATGTGCAGATCACTGACCCGGCGATTGTGGCGGCGG
CAACATTATCTCACCGCTATATCGCCGACCGTCAGTTACCGGATAAAGCTATCGACCTCATCGATGAAGC
GGCATCCAGCATTCGTATGCAGATTGACTCGAAGCCGGAGGAGCTGGACAGGCTCGACCGCCGCATTATT
CAGCTCAAACTGGAACAGCAGGCGTTGATGAAAGAGTCTGACGAGGCGAGTAAAAAACGTCTCGATATGC
TGAATGAAGAACTGGACGATAAAGAGCGTCAGTACTCTGAGTTAGAAGAAGAGTGGAAAGCGGAAAAAGC
GTCGCTCTCTGGTACGCAAACTATTAAAGCGGAGCTGGAGCAGGCGAAGATCGCCATCGAGCAGGCGCGT
CGCGTTGGCGACCTCGCGCGAATGTCTGAACTGCAGTACGGCAAAATTCCGGAGCTGGAAAAACAGCTGG
AAGCCGCGACCCAGTCGGAAGGTAAAACCATGCGTCTGTTACGTAACAAAGTAACGGATGCGGAAATTGC
CGAAGTGCTGGCGCGCTGGACCGGTATTCCGGTTTCCAGAATGCTGGAAGGCGAACGTGAAAAACTGTTG
CGTATGGAACAAGAGTTACACAGCCGTGTGATCGGGCAGAATGAAGCCGTTGAAGCAGTATCGAACGCCA
TACGCCGTAGCCGCGCGGGGCTGTCCGATCCGAACCGTCCGATTGGTTCCTTCCTGTTCCTTGGGCCGAC
CGGGGTCGGTAAAACCGAACTGTGTAAAGCGCTGGCTAACTTTATGTTCGACAGCGACGACGCGATGGTG
CGTATCGACATGTCTGAGTTTATGGAGAAACACTCCGTGTCTCGTTTGGTCGGGGCGCCTCCAGGATATG
TCGGCTATGAAGAAGGCGGTTATTTGACGGAAGCGGTGCGCCGTCGCCCTTATTCCGTCATCTTGTTGGA
TGAAGTGGAAAAAGCGCATCCGGATGTATTCAACATTCTGTTGCAGGTGCTGGACGACGGTCGACTGACT
GACGGGCAGGGGAGAACGGTCGACTTCCGTAATACGGTGGTCATTATGACTTCTAACCTCGGTTCCGATC
TCATTCAGGAGCGCTTTGGCGAACTGGATTACGGTCGAATGAAAGAGATGGTGCTGGGTGTGGTTAGCCA
AAACTTCCGTCCGGAATTTATCAACCGTATTGATGAAGTTGTGGTATTCCATCCGTTAGGTGAGCAACAC
ATCGCTTCTATTGCTCAGATCCAGCTGCAGCGTCTGTACAAACGTCTGGAAGAACGTGGTTATGAAATCC
ATATCTCCGACGAGGCGCTGAAACTGTTGAGCGCCAACGGTTACGATCCGGTCTACGGGGCGCGTCCGTT
AAAACGTGCTATTCAACAGCAGATCGAAAACCCACTGGCGCAGCAAATCCTGTCTGGTGAACTGGTTCCT
GGCAAAGTGATTCGCCTTGAAGCCAATGATGATCGTATTGTGGCAGTGCAGTAA