SecReT6
Protein ID: 488655083
SecReT6 ID763
T6SS typei3
Gene symbol-
Locus tagTY21A_13165
StrainSalmonella enterica subsp. enterica serovar Typhi str. Ty21a
Repliconchromosome [GenBank: NC_021176] [Browse all T6SS(s) in this replicon]
Location [Strand]2672322..2673146 [+]
Producthypothetical protein
NoteTagJ
UniProt IDN0BZ71
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 7.30E-46, Aligned region: 143..266
Protein Sequence: 274 a.a.     [Download]
>gi|488655083|ref|YP_007926886.1| hypothetical protein TY21A_13165 [Salmonella enterica subsp. enterica serovar Typhi str. Ty21a]
MKKTDTLPATLSALLQEYSIAEGIQMAEQQVRENPAKALCRHSLFQLLCVAGDWARALHQLQLCARMEAN
YTQEARLYRELVCCEMFRHTVFQGEQRPGFLLPQPVWVESLLAALACHDDTGEVDKHRNTALEAITDTGG
QWNGGAFDWASDSDSRLGPVLELVTGGVYIWLPFSQIRSLESPQPTRLTDLLWKPVNITLVNGDTHGAWL
FTRYSGSESASDALRLCRETAWQDGPGETTVRALGQKVWLTSHGDISLLDMTHCTFHAQENDGA
 
Nucleotide Sequence: 825 bp     [Download]
>gi|488652559|ref|NC_021176.1|:2672322-2673146 Salmonella enterica subsp. enterica serovar Typhi str. Ty21a, complete genome
ATGAAAAAAACTGACACGCTTCCTGCTACCCTGTCCGCGCTGCTACAGGAATACTCTATTGCGGAGGGGA
TTCAGATGGCGGAGCAGCAGGTTCGGGAAAATCCGGCGAAGGCGCTCTGCCGCCACAGCCTGTTTCAGTT
GCTGTGTGTGGCCGGAGACTGGGCGCGGGCGCTACACCAGCTTCAGCTCTGTGCCAGGATGGAGGCAAAT
TATACCCAGGAGGCCCGGCTGTACCGGGAGCTGGTTTGCTGCGAAATGTTCCGCCACACCGTTTTTCAGG
GTGAACAACGACCCGGTTTTCTTCTGCCGCAGCCCGTTTGGGTGGAGTCACTGCTGGCGGCACTCGCCTG
TCATGACGATACCGGTGAGGTTGATAAACACCGTAATACCGCACTGGAAGCCATAACAGACACGGGCGGG
CAGTGGAACGGCGGCGCATTTGACTGGGCGAGCGACAGCGATTCCCGCCTTGGCCCGGTACTTGAGCTGG
TCACCGGCGGCGTGTATATCTGGCTACCGTTTTCGCAAATACGCTCGCTGGAATCGCCGCAACCGACGCG
CCTGACCGATCTGCTGTGGAAACCCGTTAATATCACCCTGGTGAATGGCGATACGCACGGTGCCTGGCTC
TTTACCCGTTACAGCGGTTCGGAAAGTGCATCTGACGCCCTGCGTCTGTGCCGGGAAACCGCCTGGCAGG
ACGGCCCCGGCGAAACCACCGTGCGAGCGCTGGGGCAGAAAGTGTGGCTGACCAGCCACGGCGATATCAG
CCTGCTGGACATGACCCATTGTACCTTTCATGCTCAGGAAAACGATGGCGCATGA