SecReT6
Protein ID: 488655084
SecReT6 ID763
T6SS typei3
Gene symbol-
Locus tagTY21A_13170
StrainSalmonella enterica subsp. enterica serovar Typhi str. Ty21a
Repliconchromosome [GenBank: NC_021176] [Browse all T6SS(s) in this replicon]
Location [Strand]2673143..2673637 [+]
Productputative cytoplasmic protein
NoteTssE
UniProt IDN0BXM7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 9.10E-22, Aligned region: 35..147
Protein Sequence: 164 a.a.     [Download]
>gi|488655084|ref|YP_007926887.1| putative cytoplasmic protein [Salmonella enterica subsp. enterica serovar Typhi str. Ty21a]
MSTSRFTPANHLLPTLFDRLCDNAPYQKIDRDISVTPVQLKEIIRRDLSFLLNTISHEGDIDARRYPQAA
ASVLNYGLPPLAGSFMYEHKWDDISEAIRRAIIRFEPRLNAATLRVTPLLDEARQGSYNTLQFEIRGQIL
TQPYPTEFLVRSALDMELSRITFF
 
Nucleotide Sequence: 495 bp     [Download]
>gi|488652559|ref|NC_021176.1|:2673143-2673637 Salmonella enterica subsp. enterica serovar Typhi str. Ty21a, complete genome
ATGAGCACGTCTCGTTTTACACCCGCTAACCACCTGCTGCCTACGCTGTTTGATCGGCTGTGTGACAATG
CTCCGTATCAGAAAATTGACCGGGATATCAGCGTCACGCCGGTACAACTGAAGGAGATCATTCGTCGGGA
TCTCTCCTTTTTGCTCAATACCATTAGCCACGAGGGTGACATCGACGCCCGGCGCTATCCGCAGGCGGCG
GCGTCAGTGCTCAACTATGGCCTGCCGCCGCTGGCGGGCAGCTTTATGTATGAGCACAAGTGGGACGATA
TCAGCGAGGCGATCCGGCGCGCCATTATCCGTTTCGAACCCCGGCTGAACGCCGCCACACTCAGGGTCAC
GCCCTTGCTCGATGAAGCCCGGCAGGGTAGCTATAACACGCTACAGTTTGAAATTCGCGGACAAATTCTG
ACGCAGCCGTATCCCACGGAGTTTCTGGTACGCAGCGCGCTGGATATGGAGCTGAGCCGCATTACGTTCT
TTTAA