SecReT6
Protein ID: 50122351
SecReT6 ID40
T6SS typei1
Gene symbol-
Locus tagECA3427
StrainPectobacterium atrosepticum SCRI1043
Repliconchromosome [GenBank: NC_004547] [Browse all T6SS(s) in this replicon]
Location [Strand]3839060..3841096 [-]
Producthypothetical protein
NoteTssI
UniProt IDQ6D1L8
KEGG IDeca:ECA3427
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 9.70E-71, Aligned region: 30..328
Phage_GPD [PF05954], Evalue: 9.70E-71, Aligned region: 491..531
Phage_base_V [PF04717], Evalue: 3.50E-21, Aligned region: 367..459
Protein Sequence: 678 a.a.     [Download]
>gi|50122351|ref|YP_051518.1| unnamed protein product [Pectobacterium atrosepticum SCRI1043]
MANSTGLQFTVKVGALEAGTFAVVDFSLDEGLNRPFSLSLSLASALPDVDFGAVLDQPCELMIWYEGELK
RRVSGIISGFTQGDTGFRRTRYQAEVRPALWRLGLRTNARIFQAQKPEAIIGTLLEEAGITDYAFALRHE
HAVREYCVQYRESDLAFITRLAAEEGLYFFHEFEEGKHRVVFADDAGALTKGPELFFNLATQGLSEGEYV
RRFHYAERVSTAEVELKDYNFKTPAYGLSHKKMSGELEHQRESYQHYDYPGRYKQDPSGKAFSGYRLDAL
RSGAVTSEGESNCAGLMPGNTFTLTEHPNATLNAVWQTVSVTHVGQQPQALEEESGGEPTTMSNSFAVVK
GTTTWRAAMPYKPMVDGPQIATVVGPAGEEIYCDQFGRVKLQFPWDRYGASNDQSSCWVRVSQGWAGGQY
GMIAIPRISHEVIVSFLEGDPDQPIITGRTFHATNPTPYVLPAHKTRTTLRTDTHKGSGFNELRFEDEAT
REQIYYHAQKDMDGVINNIHRQSVGRDQHLSVAQDQFQRVDRHRHRTIGKDDFENIGQDHHQEIGRSFIQ
KIGSSFKRFIGGGEITRIEGSRQTTMSGSEETLIGAHQRILVNTDSYLKAADIVLEAGQALTIKAPGGFI
KIDSAGVTISGTIVKINDGGAAGVGTAPVSITPEDPSKPTLPDAPDRR
 
Nucleotide Sequence: 2037 bp     [Download]
>gi|50118965|ref|NC_004547.2|:c3841096-3839060 Pectobacterium atrosepticum SCRI1043 chromosome, complete genome
ATGGCAAACAGTACAGGATTACAGTTTACCGTAAAGGTCGGTGCTCTGGAGGCCGGCACCTTTGCGGTGG
TGGATTTCAGTCTGGATGAGGGGTTGAATCGGCCCTTCAGCCTGTCGCTGAGTCTGGCGAGCGCGTTGCC
GGATGTCGATTTCGGTGCGGTGCTGGATCAGCCGTGCGAACTGATGATTTGGTATGAAGGCGAACTGAAG
CGTCGGGTCAGCGGGATTATCAGTGGGTTTACTCAAGGCGACACCGGATTTCGGCGCACGCGCTATCAGG
CGGAAGTCCGTCCGGCGCTGTGGCGACTGGGTCTTCGCACCAACGCCCGCATCTTTCAGGCGCAGAAGCC
GGAAGCGATTATCGGCACATTGCTGGAAGAAGCAGGCATTACCGACTACGCGTTTGCGCTGCGCCATGAG
CACGCCGTGCGGGAATACTGCGTACAGTATCGGGAAAGTGATTTAGCCTTTATCACTCGGCTGGCCGCAG
AGGAAGGCCTGTACTTCTTCCACGAGTTTGAGGAGGGCAAGCATCGAGTGGTGTTTGCCGATGATGCGGG
TGCGCTGACCAAAGGGCCGGAGCTGTTCTTCAATCTCGCCACGCAGGGGTTAAGTGAGGGCGAATATGTC
CGGCGTTTCCACTACGCGGAGCGGGTGAGCACGGCCGAAGTGGAACTGAAGGACTACAACTTCAAGACGC
CGGCTTACGGACTGTCACACAAGAAGATGAGCGGTGAGCTGGAGCACCAGCGTGAAAGCTATCAGCATTA
CGACTATCCGGGACGTTATAAGCAAGATCCGAGCGGCAAGGCGTTCAGCGGCTATCGTCTGGATGCGCTG
CGCTCAGGGGCGGTGACAAGCGAAGGGGAGTCCAACTGCGCGGGGCTGATGCCGGGCAATACCTTTACCC
TGACGGAGCATCCGAATGCGACGCTGAACGCAGTGTGGCAGACAGTGAGTGTGACGCACGTCGGGCAGCA
GCCGCAGGCGCTGGAAGAGGAAAGCGGCGGCGAACCGACGACCATGAGCAACAGCTTTGCGGTGGTGAAG
GGCACAACGACGTGGCGCGCGGCGATGCCGTACAAACCGATGGTGGACGGCCCGCAAATCGCGACGGTGG
TGGGTCCGGCGGGTGAAGAAATTTACTGTGATCAGTTCGGCCGGGTAAAACTGCAATTCCCGTGGGATCG
CTATGGCGCGAGCAACGACCAGAGCTCTTGCTGGGTGCGCGTCAGTCAGGGCTGGGCGGGTGGCCAGTAC
GGCATGATCGCTATCCCACGTATCAGCCATGAAGTGATCGTCAGCTTCCTCGAAGGTGACCCAGACCAGC
CTATTATCACTGGGCGTACGTTCCACGCGACCAACCCGACGCCGTACGTTTTACCCGCACATAAAACGCG
CACGACGCTGCGTACTGATACGCACAAAGGCAGTGGCTTCAACGAACTGCGTTTCGAGGATGAGGCGACG
CGTGAACAAATTTACTATCACGCTCAGAAAGATATGGATGGTGTCATCAATAACATCCATCGGCAGAGTG
TGGGGCGCGATCAGCATCTCAGCGTCGCTCAGGATCAGTTCCAACGAGTCGATCGTCACCGTCACCGAAC
GATAGGCAAAGATGACTTTGAAAATATCGGTCAGGATCATCATCAGGAAATTGGCCGGAGTTTTATTCAG
AAAATAGGCTCTTCGTTCAAGCGCTTTATCGGTGGGGGAGAGATTACCCGTATCGAAGGGAGCCGCCAGA
CCACGATGTCCGGTTCTGAAGAGACGCTGATCGGGGCGCATCAGCGTATTCTGGTCAATACGGACAGCTA
CCTGAAAGCCGCAGATATCGTGCTGGAAGCGGGGCAGGCTCTGACTATTAAAGCGCCTGGCGGTTTTATC
AAGATTGATAGCGCGGGTGTCACAATTTCCGGGACGATTGTGAAAATCAACGATGGTGGTGCGGCTGGCG
TAGGGACTGCGCCGGTGTCGATTACGCCAGAAGACCCCTCGAAGCCTACGCTGCCGGATGCGCCAGACAG
ACGTTAA