SecReT6
Protein ID: 50122354
SecReT6 ID40
T6SS typei1
Gene symbol-
Locus tagECA3431
StrainPectobacterium atrosepticum SCRI1043
Repliconchromosome [GenBank: NC_004547] [Browse all T6SS(s) in this replicon]
Location [Strand]3843747..3845183 [-]
Producthypothetical protein
NoteTssA
UniProt IDQ6D1L5
KEGG IDeca:ECA3431
PDB IDNA
Domain hit(s) vs Pfam DUF3702 [PF12486], Evalue: 2.40E-40, Aligned region: 326..473
ImpA-rel_N [PF06812], Evalue: 1.10E-18, Aligned region: 39..98
Protein Sequence: 478 a.a.     [Download]
>gi|50122354|ref|YP_051521.1| unnamed protein product [Pectobacterium atrosepticum SCRI1043]
MQDAQQALKVGRDPRMLPEFDALRAEINKLSHASRPDVDWMLVHDMATTIFEKQGVDLQTAIYFTLARSR
LAGLTGFTESCEFLANLIVTQWDNFWPPVHQERARIEMLDWFIARISEVVRQYAISHEHKRLVYRCERAL
QLMSEKLHNSGLSRIPRVENLLHFVEGYTHLFDETEIVIVSDDQELRKQDMQIPPMVFFHSDMEPGATVQ
SGGSSGSGQAALPAGSILIGREKGQMKPTVLKIEAHKKQKPAWFWFVSGLLACALPVAAITGWQYWQEQK
ADALALLQQPAYALPSAPDHNDIRRVRIVLGEQKLQGMEGELINRYQAQLEQVKNASPFYLYQYGNGLKN
VMQQLYPDSLAVKEMERQWQITLERQQGDEPKTLGYEQARARVNDTLQQLLELERQRRTVTISYLKSKLY
DMQKDLISDVPFGIRLRELEARKIKSQSLTPAELRGMEDELRAFNIRLYRLQQSNSAS
 
Nucleotide Sequence: 1437 bp     [Download]
>gi|50118965|ref|NC_004547.2|:c3845183-3843747 Pectobacterium atrosepticum SCRI1043 chromosome, complete genome
ATGCAAGATGCACAACAGGCCCTGAAAGTGGGCCGAGATCCACGGATGCTGCCGGAATTTGACGCACTTC
GGGCGGAAATTAACAAGTTGAGTCACGCGTCTCGTCCCGATGTGGATTGGATGCTGGTACACGATATGGC
CACCACCATCTTTGAAAAACAGGGTGTGGATCTCCAGACTGCGATCTATTTCACTCTGGCGCGCTCACGG
CTGGCTGGATTGACGGGCTTCACGGAAAGCTGTGAGTTTCTGGCGAACCTGATCGTGACGCAGTGGGATA
ACTTCTGGCCGCCGGTGCATCAGGAGCGGGCACGTATCGAGATGCTGGACTGGTTCATTGCCCGCATCAG
CGAGGTGGTGCGGCAGTACGCCATCAGCCATGAACACAAGCGGCTGGTTTATCGTTGCGAACGTGCGCTG
CAACTGATGAGTGAAAAACTGCATAATTCCGGCTTGAGTCGTATTCCTCGCGTCGAGAATTTGCTGCACT
TCGTCGAAGGTTATACCCATTTGTTTGATGAAACCGAGATTGTCATTGTGTCGGACGATCAGGAACTGAG
AAAGCAGGATATGCAGATTCCACCCATGGTGTTCTTTCATTCAGACATGGAACCCGGCGCAACGGTGCAA
AGCGGTGGTTCATCAGGCTCGGGTCAGGCTGCGCTGCCCGCGGGCAGCATTCTCATCGGACGGGAGAAAG
GGCAAATGAAACCAACGGTATTGAAAATTGAGGCGCATAAAAAACAGAAGCCAGCCTGGTTCTGGTTTGT
CTCTGGGCTGCTGGCCTGTGCGTTACCAGTTGCGGCCATTACGGGCTGGCAGTATTGGCAGGAGCAAAAA
GCGGATGCGCTGGCATTACTGCAACAGCCTGCGTACGCCTTGCCTAGTGCCCCCGACCATAATGATATTC
GTCGAGTGCGTATTGTCCTGGGTGAGCAGAAATTGCAGGGTATGGAAGGCGAACTGATCAACCGCTATCA
GGCACAGCTGGAGCAGGTGAAAAATGCGTCGCCATTCTATCTGTACCAATACGGCAATGGGTTGAAAAAC
GTGATGCAGCAGCTCTATCCCGATTCGCTGGCGGTGAAGGAGATGGAGCGCCAATGGCAGATTACGCTTG
AACGCCAGCAGGGTGATGAGCCGAAAACGCTGGGTTACGAACAGGCTCGCGCCAGAGTCAACGATACGTT
ACAGCAACTGCTGGAATTGGAACGTCAGCGGCGGACGGTGACGATCTCCTACCTGAAATCAAAACTCTAC
GATATGCAAAAAGATCTGATATCGGATGTCCCCTTTGGGATACGGCTGCGTGAACTTGAGGCGCGTAAAA
TCAAGAGCCAATCACTGACGCCAGCGGAGCTGCGCGGTATGGAAGATGAACTGCGCGCCTTCAATATTCG
CTTGTATCGTTTGCAGCAGAGTAATTCAGCTAGCTGA