SecReT6
Protein ID: 50122356
SecReT6 ID40
T6SS typei1
Gene symbol-
Locus tagECA3433
StrainPectobacterium atrosepticum SCRI1043
Repliconchromosome [GenBank: NC_004547] [Browse all T6SS(s) in this replicon]
Location [Strand]3848755..3850173 [-]
Producthypothetical protein
NoteTssA
UniProt IDQ6D1L3
KEGG IDeca:ECA3433
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 7.70E-16, Aligned region: 50..109
Protein Sequence: 472 a.a.     [Download]
>gi|50122356|ref|YP_051523.1| unnamed protein product [Pectobacterium atrosepticum SCRI1043]
MHAHPWCKRLQTSLPDERLRAAVLADDPLWEKVETELVKLGSLAHNQVDLNVVAGYCLTLLESKTKDMRV
LVQLLRCLQHPAKATPFSTALMLLDSWLESYWVTAWPASPVQKQKLMIQIVRRFEGAIPRIAETASSAEL
EQLQKLTEQVATRWGELASDKAALMDELVQGFKRARQRQQAQEQANQTAKPTSAASGSSGVSETSASAAS
TPVSSVEINSSDERSWRQTQLNVAALLVERHPDSPMGYRLRRHAIWSGIATPPMSSKGHKTQLAPVSSDR
VDEYQSALAQADLALWERIEQSLVLAPYWFDGHMLSASVASRLGHSSVATAMAEELSAFIQRLPELRELA
FSDGAPFLTGKCSQWLQSSQPVRGGGGARQDDLATEAASCRDEKGIGAAMLLLDERMRRLKEPRDRFYAE
LVLADLLAEEGMKSLAAQHYQHMWQESQQLGLMQWEPGMVSRVERLAASRKK
 
Nucleotide Sequence: 1419 bp     [Download]
>gi|50118965|ref|NC_004547.2|:c3850173-3848755 Pectobacterium atrosepticum SCRI1043 chromosome, complete genome
ATGCATGCACATCCTTGGTGTAAACGCCTGCAAACCTCGTTGCCGGATGAGAGGTTGCGCGCGGCGGTAT
TGGCTGACGATCCGCTCTGGGAAAAGGTAGAAACGGAGCTGGTCAAGCTAGGATCGCTGGCGCATAACCA
GGTCGATCTTAACGTGGTGGCGGGTTATTGCCTGACGTTACTGGAAAGCAAAACCAAAGACATGCGGGTA
CTGGTTCAGCTACTGCGCTGCTTACAGCACCCCGCTAAAGCGACACCGTTTTCTACCGCACTGATGCTGC
TGGATAGCTGGCTGGAGAGCTACTGGGTTACCGCCTGGCCTGCTAGCCCGGTTCAGAAACAAAAGTTGAT
GATCCAGATTGTTCGGCGTTTTGAGGGCGCGATCCCTCGTATTGCGGAGACTGCATCCAGCGCAGAGTTA
GAGCAGTTACAGAAATTAACCGAGCAGGTGGCGACCCGCTGGGGCGAGCTGGCCAGCGACAAAGCGGCGC
TGATGGATGAATTGGTGCAAGGCTTTAAGCGTGCCAGACAGCGGCAGCAGGCGCAGGAACAGGCGAATCA
GACGGCGAAACCAACCTCGGCAGCCAGCGGTAGCTCAGGCGTAAGTGAAACCAGTGCCAGCGCTGCCTCG
ACGCCAGTCAGTTCGGTGGAGATTAACTCATCTGATGAACGCAGTTGGCGACAAACTCAGTTGAACGTCG
CCGCATTGCTGGTTGAGCGTCATCCTGATTCACCGATGGGCTATCGTCTGCGACGCCATGCTATCTGGTC
CGGTATTGCCACACCGCCGATGTCGTCGAAGGGACATAAAACTCAGTTGGCACCCGTCTCGTCAGACCGC
GTGGATGAATACCAAAGTGCGCTTGCACAAGCCGATTTGGCGCTGTGGGAACGTATAGAACAAAGCCTGG
TGTTGGCACCTTACTGGTTTGATGGCCACATGCTGTCTGCTTCGGTGGCATCTCGGCTGGGGCATTCCTC
TGTCGCTACGGCGATGGCTGAAGAGCTTTCTGCCTTTATTCAGCGTTTGCCTGAACTGCGGGAGCTGGCG
TTCAGCGATGGCGCACCATTTTTGACTGGGAAGTGCAGCCAATGGTTGCAGTCCAGCCAGCCAGTGCGCG
GCGGTGGCGGTGCGCGGCAGGACGATCTGGCAACGGAGGCAGCCTCCTGTCGGGATGAGAAAGGCATCGG
TGCGGCGATGTTGTTACTGGATGAACGTATGCGTCGCTTGAAAGAGCCTCGCGATCGCTTTTATGCCGAG
TTGGTACTGGCGGATTTACTCGCCGAAGAAGGGATGAAATCACTGGCAGCACAGCACTATCAGCACATGT
GGCAGGAAAGCCAGCAATTGGGCCTGATGCAATGGGAACCGGGAATGGTCAGCCGCGTGGAGCGGTTGGC
AGCATCCCGTAAAAAATAA