SecReT6
Protein ID: 50122359
SecReT6 ID40
T6SS typei1
Gene symbol-
Locus tagECA3436
StrainPectobacterium atrosepticum SCRI1043
Repliconchromosome [GenBank: NC_004547] [Browse all T6SS(s) in this replicon]
Location [Strand]3852301..3854898 [-]
Productchaperone
NoteTssH
UniProt IDQ6D1L0
KEGG IDeca:ECA3436
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 4.70E-38, Aligned region: 275..325
AAA_2 [PF07724], Evalue: 4.70E-38, Aligned region: 602..763
AAA [PF00004], Evalue: 3.30E-17, Aligned region: 219..331
AAA [PF00004], Evalue: 3.30E-17, Aligned region: 608..726
AAA_5 [PF07728], Evalue: 1.50E-13, Aligned region: 219..239
AAA_5 [PF07728], Evalue: 1.50E-13, Aligned region: 432..463
AAA_5 [PF07728], Evalue: 1.50E-13, Aligned region: 607..725
ClpB_D2-small [PF10431], Evalue: 2.00E-11, Aligned region: 427..443
ClpB_D2-small [PF10431], Evalue: 2.00E-11, Aligned region: 769..843
AAA_16 [PF13191], Evalue: 3.40E-10, Aligned region: 135..175
AAA_16 [PF13191], Evalue: 3.40E-10, Aligned region: 196..236
AAA_16 [PF13191], Evalue: 3.40E-10, Aligned region: 257..297
AAA_16 [PF13191], Evalue: 3.40E-10, Aligned region: 413..482
AAA_16 [PF13191], Evalue: 3.40E-10, Aligned region: 464..533
AAA_16 [PF13191], Evalue: 3.40E-10, Aligned region: 580..646
AAA_16 [PF13191], Evalue: 3.40E-10, Aligned region: 673..701
AAA_22 [PF13401], Evalue: 1.80E-07, Aligned region: 218..309
AAA_22 [PF13401], Evalue: 1.80E-07, Aligned region: 606..625
AAA_22 [PF13401], Evalue: 1.80E-07, Aligned region: 669..701
NACHT [PF05729], Evalue: 6.70E-05, Aligned region: 219..246
NACHT [PF05729], Evalue: 6.70E-05, Aligned region: 414..449
NACHT [PF05729], Evalue: 6.70E-05, Aligned region: 608..631
NACHT [PF05729], Evalue: 6.70E-05, Aligned region: 813..842
DUF258 [PF03193], Evalue: 0.0001, Aligned region: 184..236
DUF258 [PF03193], Evalue: 0.0001, Aligned region: 608..623
AAA_29 [PF13555], Evalue: 0.0003, Aligned region: 214..236
AAA_29 [PF13555], Evalue: 0.0003, Aligned region: 605..629
Arch_ATPase [PF01637], Evalue: 0.0005, Aligned region: 199..233
Arch_ATPase [PF01637], Evalue: 0.0005, Aligned region: 272..306
Arch_ATPase [PF01637], Evalue: 0.0005, Aligned region: 608..628
Arch_ATPase [PF01637], Evalue: 0.0005, Aligned region: 678..693
AAA_25 [PF13481], Evalue: 0.0011, Aligned region: 219..243
AAA_25 [PF13481], Evalue: 0.0011, Aligned region: 428..451
AAA_25 [PF13481], Evalue: 0.0011, Aligned region: 602..636
AAA_25 [PF13481], Evalue: 0.0011, Aligned region: 767..803
AAA_19 [PF13245], Evalue: 0.0015, Aligned region: 216..241
AAA_19 [PF13245], Evalue: 0.0015, Aligned region: 355..396
AAA_19 [PF13245], Evalue: 0.0015, Aligned region: 601..625
AAA_19 [PF13245], Evalue: 0.0015, Aligned region: 802..824
AAA_17 [PF13207], Evalue: 0.0016, Aligned region: 219..285
AAA_17 [PF13207], Evalue: 0.0016, Aligned region: 474..508
AAA_17 [PF13207], Evalue: 0.0016, Aligned region: 608..642
Sigma54_activat [PF00158], Evalue: 0.0027, Aligned region: 219..233
Sigma54_activat [PF00158], Evalue: 0.0027, Aligned region: 607..705
IstB_IS21 [PF01695], Evalue: 0.0032, Aligned region: 213..243
IstB_IS21 [PF01695], Evalue: 0.0032, Aligned region: 483..512
IstB_IS21 [PF01695], Evalue: 0.0032, Aligned region: 607..618
Zeta_toxin [PF06414], Evalue: 0.0042, Aligned region: 216..236
Zeta_toxin [PF06414], Evalue: 0.0042, Aligned region: 606..647
AAA_10 [PF12846], Evalue: 0.0061, Aligned region: 217..238
AAA_10 [PF12846], Evalue: 0.0061, Aligned region: 281..305
AAA_10 [PF12846], Evalue: 0.0061, Aligned region: 350..427
AAA_10 [PF12846], Evalue: 0.0061, Aligned region: 607..638
Ras [PF00071], Evalue: 0.008, Aligned region: 219..232
Ras [PF00071], Evalue: 0.008, Aligned region: 608..649
Protein Sequence: 865 a.a.     [Download]
>gi|50122359|ref|YP_051526.1| unnamed protein product [Pectobacterium atrosepticum SCRI1043]
MIRIELPTLVERLNPVCRHMLEEAAALCIQHQGAEIRIEHLLMKMLETPLCDVRQILKRAGVDADELSSL
LLPSSVDKEFDAGYPSFSPLLVEWLQDSWLLASAEFQHAQLRSGILLLVLLLTPNRYVAGAVSRPLAQIN
RELLRQQFDEWVKDSVETEVATRSATAEQAAAATTQLSRYTQNVTESARQGQLDPVLCRDHEIDLMIDIL
SRRRKNNPIVVGEAGVGKSALIEGLALRIVAGAVPERLRDVELLTLDLGAMQAGASVKGEFEKRFKGVMQ
EVKDAPRPIILFIDEAHTLIGAGNQAGGLDVSNLLKPALARGELRTIAATTWSEYKKYVEKDAALSRRFQ
LVKVGEPNAEEATVILRGLRSIYEKAHGVLIDEDALQAAAQLSARYISGRQLPDKAIDVLDTASARVAIN
LTTPPRAVSQLQTRLHQQKMEITQLERQARIGLGNTEERLVELRDAREAGAASLAQLEADWQQQKTQVQR
VIELRTALLDDEQTVDFDAVSAAAELATCEQALEILQQASVLVSPHVDKMQIAAVIAEWTGVPLNRISQG
EMDIVTRLPEFLGESIKGQQLAIAQLHKHLLTARADLRRPGRPLGAFLLVGPSGVGKTETVVQIADLMFG
GRNYLTTINMSEYQEKHTVSRLIGSPPGYVGFGEGGVLTEAIRQKPYSVVLLDEVEKAHPDVLNLFYQAF
DKGELADGEGRVIDCRNVVFFLTSNLGFQTIVNYAEQSDVLLDALYPELAAFFKPALLARMEVIPYLPLA
HDTMVEIVQGKLSRLVSLLQQRFGAEVIIEDEVPEEILRLANRSENGARMLESVIDGALLPPVSLQLLQR
MSAGEPVSRIHFRVEAGQFQTEVEG
 
Nucleotide Sequence: 2598 bp     [Download]
>gi|50118965|ref|NC_004547.2|:c3854898-3852301 Pectobacterium atrosepticum SCRI1043 chromosome, complete genome
GTGATTCGAATTGAACTGCCGACACTGGTTGAACGACTTAACCCCGTGTGCCGTCATATGCTGGAAGAAG
CGGCGGCACTTTGTATTCAACATCAGGGAGCGGAAATCCGTATTGAGCACCTGTTGATGAAAATGCTGGA
AACGCCGCTGTGTGATGTGCGCCAGATCCTCAAGCGCGCGGGTGTCGATGCGGATGAGCTGTCTTCGCTG
CTGTTACCTTCTTCCGTGGATAAAGAATTTGATGCGGGCTATCCCTCATTCTCTCCTCTGCTGGTGGAAT
GGTTACAGGACAGCTGGCTGCTGGCCTCGGCTGAATTCCAACATGCGCAGCTGCGCAGCGGCATCTTGCT
GCTGGTTTTGCTGCTGACGCCAAATCGCTATGTAGCAGGGGCTGTATCCCGCCCGCTGGCGCAGATTAAC
CGTGAGCTTTTACGTCAGCAGTTTGATGAGTGGGTCAAGGATTCCGTTGAAACGGAGGTGGCGACGCGCT
CCGCTACAGCGGAGCAGGCTGCTGCGGCGACTACCCAGCTCTCTCGCTATACCCAAAACGTGACGGAATC
TGCCCGACAGGGGCAGTTGGATCCGGTGCTGTGTCGCGATCATGAAATCGATCTGATGATCGACATTCTC
TCCCGTCGCCGTAAAAACAACCCGATTGTGGTGGGGGAAGCGGGCGTCGGTAAAAGTGCGCTGATCGAAG
GGCTAGCGCTGCGTATTGTGGCGGGTGCCGTACCGGAAAGATTGCGGGATGTAGAACTGCTCACGCTCGA
TCTGGGAGCGATGCAGGCCGGTGCGTCAGTTAAAGGCGAATTTGAGAAACGCTTCAAAGGTGTGATGCAG
GAAGTGAAAGATGCACCACGCCCGATCATTCTGTTTATCGATGAAGCGCATACGCTAATTGGGGCTGGCA
ATCAGGCTGGCGGGCTGGATGTGTCCAACCTGCTCAAGCCTGCGCTGGCACGCGGTGAATTGCGCACGAT
CGCAGCGACGACCTGGAGTGAATACAAAAAATACGTCGAGAAAGATGCGGCGCTTTCCCGTCGCTTCCAG
CTCGTCAAGGTCGGTGAACCGAACGCGGAAGAAGCCACCGTTATCCTGCGTGGGCTGCGCAGCATCTATG
AAAAAGCACACGGCGTACTGATTGATGAAGATGCACTTCAGGCGGCGGCGCAGCTGTCGGCGCGCTATAT
CTCCGGTCGCCAACTGCCCGATAAAGCCATTGACGTGCTGGATACCGCGAGTGCGCGCGTGGCGATTAAC
CTGACGACGCCACCGCGTGCAGTCAGCCAGCTACAGACTCGCCTGCATCAGCAGAAAATGGAAATCACCC
AGCTTGAGCGTCAGGCGCGCATCGGTCTGGGTAATACTGAAGAGCGGTTAGTCGAACTGCGTGACGCCCG
CGAAGCGGGGGCGGCATCGCTGGCACAGCTGGAAGCCGATTGGCAGCAGCAGAAAACACAGGTTCAACGC
GTGATTGAACTGCGTACGGCGCTGTTGGATGACGAGCAAACCGTCGACTTTGATGCGGTATCGGCAGCGG
CGGAACTGGCTACCTGTGAGCAAGCACTGGAAATACTTCAGCAAGCTTCCGTGCTGGTCTCTCCCCACGT
CGATAAAATGCAGATTGCGGCAGTGATTGCCGAATGGACGGGCGTGCCGCTGAACCGAATTTCACAGGGT
GAAATGGATATCGTCACCCGCCTGCCTGAATTCCTGGGAGAGTCGATTAAAGGGCAGCAGTTAGCGATTG
CCCAATTGCATAAACATTTACTGACTGCGCGTGCGGATCTCCGTCGTCCGGGGCGTCCGCTAGGTGCTTT
CCTGCTGGTGGGGCCAAGCGGTGTCGGTAAAACGGAAACTGTGGTTCAGATTGCCGACCTGATGTTTGGT
GGACGTAACTATCTGACCACCATCAATATGTCGGAATATCAGGAAAAACATACGGTTTCACGCCTGATCG
GTTCGCCTCCGGGCTACGTCGGGTTTGGCGAAGGGGGCGTGTTGACCGAAGCCATCCGTCAGAAGCCGTA
CTCCGTGGTACTGCTGGATGAAGTAGAGAAAGCGCACCCGGATGTTCTGAATTTGTTCTATCAGGCGTTT
GATAAAGGTGAACTGGCCGATGGTGAAGGCCGTGTCATCGACTGCCGCAACGTGGTGTTCTTCCTGACGT
CCAATCTCGGGTTCCAGACGATCGTGAACTACGCCGAGCAGTCGGATGTGTTGCTGGATGCGCTCTATCC
CGAACTGGCGGCCTTCTTCAAACCTGCATTATTGGCGCGTATGGAAGTCATTCCTTATCTGCCGCTGGCG
CATGACACCATGGTCGAGATCGTACAGGGCAAATTGTCGCGTCTGGTTTCTCTGCTGCAACAGCGCTTTG
GTGCGGAAGTCATCATTGAAGACGAGGTGCCGGAAGAGATTCTACGGTTGGCGAACCGCAGCGAAAACGG
GGCACGTATGCTCGAATCAGTGATTGACGGGGCCTTGCTGCCACCGGTTTCGCTACAGCTACTGCAACGC
ATGTCTGCGGGTGAACCCGTTAGCCGTATTCATTTCCGTGTCGAAGCCGGCCAGTTCCAGACCGAGGTGG
AGGGCTGA