SecReT6
Protein ID: 50122360
SecReT6 ID40
T6SS typei1
Gene symbol-
Locus tagECA3437
StrainPectobacterium atrosepticum SCRI1043
Repliconchromosome [GenBank: NC_004547] [Browse all T6SS(s) in this replicon]
Location [Strand]3854912..3855688 [-]
Producthypothetical protein
NoteTssL
UniProt IDQ6D1K9
KEGG IDeca:ECA3437
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 3.40E-70, Aligned region: 38..242
Protein Sequence: 258 a.a.     [Download]
>gi|50122360|ref|YP_051527.1| unnamed protein product [Pectobacterium atrosepticum SCRI1043]
MSIEVIKNDQLGDLLFDHARQLDMDSDYWFRLRGQSINPMVDTVTPLLGMVERVRQLSAYEGVEDLYQRV
VSEIQAIEQELHSHGYENGVILSFRYILCTFIDEAVMGREWGGQSMWSAHSLLTRFHNETWGGEKVFVLL
EKLLDDPTRYRDILEFIYLCLCLGFEGRYRVMTQGREELNRVVSKLHDTLRPEPANSPTVFHLNLGQQAS
RYHLRRQVSLRTLFIGVFVVLVAAFGLYRYELTHQTQDVLRQLGELLQ
 
Nucleotide Sequence: 777 bp     [Download]
>gi|50118965|ref|NC_004547.2|:c3855688-3854912 Pectobacterium atrosepticum SCRI1043 chromosome, complete genome
ATGAGCATCGAGGTTATTAAAAACGATCAACTGGGCGATCTGCTTTTTGACCACGCCCGACAGCTGGATA
TGGACTCCGACTACTGGTTCCGCCTGCGTGGACAAAGCATTAATCCGATGGTTGATACGGTCACGCCGCT
GCTGGGCATGGTGGAGCGAGTACGCCAGCTCTCTGCTTATGAGGGCGTGGAGGATCTCTATCAGCGCGTG
GTGTCTGAAATTCAGGCCATCGAGCAGGAATTGCATTCTCATGGCTATGAAAACGGCGTGATTTTGTCCT
TCCGCTACATCCTCTGCACCTTCATTGATGAAGCCGTGATGGGACGGGAGTGGGGCGGGCAAAGCATGTG
GTCGGCCCATTCCCTGTTGACCCGTTTTCATAATGAGACCTGGGGAGGCGAAAAGGTTTTTGTCCTGCTG
GAGAAGCTGCTGGACGATCCCACCCGCTATCGCGACATTCTGGAGTTTATCTACCTTTGCCTCTGTCTGG
GCTTTGAAGGGCGCTATCGGGTGATGACTCAGGGGCGTGAGGAGTTGAACCGCGTCGTGAGTAAGTTACA
TGACACGCTGCGCCCTGAGCCTGCTAATTCGCCGACGGTCTTCCACTTGAATCTGGGGCAGCAGGCCTCG
CGTTACCACCTGCGTAGACAGGTGTCATTGCGCACGTTGTTTATCGGCGTTTTTGTGGTCTTGGTGGCCG
CATTCGGCCTGTACCGTTACGAGCTAACTCATCAAACCCAGGACGTACTGCGTCAGCTGGGAGAATTATT
ACAATAA