SecReT6
Protein ID: 50122362
SecReT6 ID40
T6SS typei1
Gene symbol-
Locus tagECA3439
StrainPectobacterium atrosepticum SCRI1043
Repliconchromosome [GenBank: NC_004547] [Browse all T6SS(s) in this replicon]
Location [Strand]3857044..3857565 [-]
Productlipoprotein
NoteTssJ
UniProt IDQ6D1K7
KEGG IDeca:ECA3439
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.50E-37, Aligned region: 11..164
Protein Sequence: 173 a.a.     [Download]
>gi|50122362|ref|YP_051529.1| unnamed protein product [Pectobacterium atrosepticum SCRI1043]
MLRALCLFSLMLLLSGCSTLGKMAQVAANPDIQVGSNNHQPSTVGFSLLAEPDVNPNDSGEAAPIEFQLV
LLAEDSRLLATDYDQITTDIEKALAKNYISHQDYTLLPGQFKYLPPEALDEKVHYLGVVARYADSESAEW
RKVIKLKNTGQTYQILVHLRRDEVEIKKDQEEE
 
Nucleotide Sequence: 522 bp     [Download]
>gi|50118965|ref|NC_004547.2|:c3857565-3857044 Pectobacterium atrosepticum SCRI1043 chromosome, complete genome
ATGCTGCGGGCACTGTGCTTATTTTCCCTGATGTTACTGCTGTCGGGGTGTTCCACGCTGGGCAAGATGG
CGCAGGTCGCGGCGAATCCGGATATCCAGGTGGGCAGCAACAATCATCAGCCTTCTACCGTGGGGTTTAG
CCTGCTGGCGGAACCGGATGTGAATCCGAACGACAGCGGTGAAGCCGCCCCTATCGAATTCCAACTGGTT
CTGCTGGCGGAAGATTCGCGTCTGTTAGCAACCGATTACGACCAGATCACGACGGATATCGAAAAAGCGT
TGGCCAAGAATTACATCAGCCATCAGGACTACACGCTATTGCCGGGGCAGTTCAAATATCTGCCGCCAGA
AGCACTGGATGAAAAGGTGCACTACCTCGGCGTGGTAGCTCGATATGCAGATTCGGAAAGCGCGGAGTGG
CGCAAAGTCATCAAGCTAAAAAATACCGGACAGACGTATCAGATCCTCGTGCACTTGCGCCGGGATGAAG
TCGAAATCAAAAAAGACCAAGAAGAAGAATAA