SecReT6
Protein ID: 50122363
SecReT6 ID40
T6SS typei1
Gene symbol-
Locus tagECA3440
StrainPectobacterium atrosepticum SCRI1043
Repliconchromosome [GenBank: NC_004547] [Browse all T6SS(s) in this replicon]
Location [Strand]3857565..3858785 [-]
Producthypothetical protein
NoteFha
UniProt IDQ6D1K6
KEGG IDeca:ECA3440
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 1.60E-05, Aligned region: 33..100
Protein Sequence: 406 a.a.     [Download]
>gi|50122363|ref|YP_051530.1| unnamed protein product [Pectobacterium atrosepticum SCRI1043]
MNVTHPLTLVVLNSEQLDINSQVQHQFDHRGGTLGASEKDQWQLRDRLGSVVPAHARIEMTDGYFSLCDL
SGQSFINGSLSPIGRDRKVILSHGDELVIGPFRLGVYIGDPTTEQDIDQVLGQRTDDVLGGWLSEDKKRR
STDLADSTVVLNDPLWALQKEQSQSLLLSDSETVGESLTTSLSSFSSAEDTMDQKFVELPTINTRYAGDE
LEGYSDGTSLAPLMRGLGLSLQPSDDARLREMLEEMGKSLRAMVEGLLALQTEQAALADTHLRPIEDNPL
RLGLGYADTLSVLFAEGKSPVHLSAPAAVEEVLNNMRVHHIANQQAIAVALENILQAFSPAALLSRFEHY
RRSGEPLAADDGWAWQMYQHYFRELTSPRQQGFQKLFHQVYAQAYDRAVRQQQEQK
 
Nucleotide Sequence: 1221 bp     [Download]
>gi|50118965|ref|NC_004547.2|:c3858785-3857565 Pectobacterium atrosepticum SCRI1043 chromosome, complete genome
GTGAACGTAACCCACCCACTCACGTTGGTTGTGCTCAACAGTGAGCAGCTCGATATCAATTCTCAGGTAC
AGCACCAGTTTGATCACCGTGGTGGCACGCTGGGCGCATCGGAAAAAGATCAGTGGCAACTACGGGATCG
GCTGGGCTCCGTGGTCCCGGCACACGCTCGTATCGAAATGACCGATGGCTATTTCAGCCTGTGCGATCTG
AGCGGCCAGTCTTTTATTAACGGTTCCCTGTCGCCGATTGGGCGAGATCGTAAAGTCATTCTGTCGCACG
GTGATGAGCTTGTGATTGGGCCTTTCCGGCTGGGCGTGTATATCGGCGATCCCACAACGGAACAGGATAT
CGATCAGGTATTAGGACAGCGCACGGACGATGTGCTGGGCGGCTGGCTAAGTGAAGATAAAAAAAGGCGC
TCTACGGATCTTGCAGACTCCACCGTCGTGTTGAACGACCCGCTGTGGGCGCTACAGAAAGAACAGAGCC
AGTCACTCTTGCTATCAGACAGTGAGACGGTCGGAGAATCACTCACGACTTCTCTTTCTTCTTTTTCTTC
TGCTGAGGACACCATGGATCAGAAATTTGTCGAATTACCGACTATCAACACACGCTATGCGGGAGATGAG
CTGGAAGGGTACAGCGACGGCACCTCATTGGCTCCGCTGATGCGCGGGCTGGGGCTGTCGCTTCAGCCGA
GCGATGATGCGCGACTGCGTGAAATGCTGGAAGAGATGGGGAAAAGCTTGCGCGCCATGGTTGAAGGCTT
GCTGGCATTGCAGACGGAACAGGCGGCACTGGCGGACACGCACTTACGCCCGATTGAAGATAACCCGCTG
CGTCTGGGGCTGGGTTATGCGGATACGCTGTCGGTGCTGTTTGCCGAGGGGAAAAGCCCAGTTCATTTGT
CAGCGCCCGCCGCGGTGGAAGAGGTGTTGAACAATATGCGAGTGCATCATATTGCGAACCAGCAGGCGAT
TGCCGTGGCGTTGGAAAACATTCTTCAGGCCTTTTCGCCAGCCGCGCTGCTTAGCCGTTTTGAACACTAT
CGTCGTAGTGGCGAACCGTTGGCTGCGGATGATGGCTGGGCGTGGCAGATGTATCAGCACTACTTCCGAG
AATTGACGTCACCCCGCCAGCAGGGTTTCCAGAAATTGTTCCATCAGGTGTATGCGCAAGCGTATGACCG
TGCCGTGCGTCAGCAGCAGGAGCAAAAATAA