SecReT6
Protein ID: 50122364
SecReT6 ID40
T6SS typei1
Gene symbol-
Locus tagECA3441
StrainPectobacterium atrosepticum SCRI1043
Repliconchromosome [GenBank: NC_004547] [Browse all T6SS(s) in this replicon]
Location [Strand]3858788..3859786 [-]
Producthypothetical protein
NoteTssG
UniProt IDQ6D1K5
KEGG IDeca:ECA3441
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.40E-95, Aligned region: 16..319
Protein Sequence: 332 a.a.     [Download]
>gi|50122364|ref|YP_051531.1| unnamed protein product [Pectobacterium atrosepticum SCRI1043]
MAGTDRSTLNDVTFRQDVSRFNFFQLVELLNQLEGVDLEQELDFRPEQERLRFRSTASIGFHPSDILKVG
CDEEGRQELEVAFLGLHGSQSPMPGYYLEELAWEYAQGEQKLGVFLDFFHHRLLTLLHRAWRKYRYHVRF
QNDGEDGFSRLMFALVGLGNDAVRDSLPVNRAKMLSYAGVLASPSRSPEVVAGLVIHCFDLDDVAVMAWQ
HRRVPIHEGQQNRLGKGNMMLGGDFVIGDKVNDCAGKFLLKVGNLSFSRFLSFLPNGEHFQPLVRFVSFI
LRDQLAWDLRLGFAEGEAKGLSLGSEQSSRLGWSSFLGQPPTDPYVTICVQE
 
Nucleotide Sequence: 999 bp     [Download]
>gi|50118965|ref|NC_004547.2|:c3859786-3858788 Pectobacterium atrosepticum SCRI1043 chromosome, complete genome
ATGGCCGGTACAGATAGGTCAACACTCAATGATGTGACGTTCCGTCAGGATGTCTCACGCTTTAATTTTT
TCCAATTGGTGGAATTGCTTAATCAACTGGAAGGCGTGGATCTGGAACAAGAACTGGATTTTCGCCCTGA
ACAGGAGCGTCTGCGCTTTCGCTCTACCGCCTCTATTGGCTTTCACCCCAGCGATATCTTGAAGGTGGGA
TGCGATGAAGAAGGCCGTCAGGAGTTGGAGGTCGCGTTTCTGGGTCTGCACGGCAGCCAGTCGCCGATGC
CAGGTTATTACCTTGAAGAGTTGGCTTGGGAGTACGCGCAGGGCGAACAGAAGCTGGGCGTATTTCTCGA
TTTCTTCCATCACCGCTTACTCACGCTGTTGCACCGCGCATGGCGAAAATATCGCTATCACGTCCGCTTT
CAGAACGATGGGGAGGATGGATTCTCTCGGTTGATGTTTGCGCTTGTAGGACTAGGGAATGACGCCGTAC
GCGACAGCCTGCCGGTTAACCGCGCCAAGATGCTTTCCTACGCCGGGGTGCTGGCAAGCCCCAGCCGTTC
ACCGGAAGTGGTCGCGGGCCTGGTTATTCACTGTTTTGACCTGGACGACGTCGCCGTCATGGCCTGGCAG
CACCGCCGCGTTCCTATTCATGAAGGGCAGCAAAATCGTCTGGGAAAAGGAAACATGATGCTGGGCGGTG
ATTTTGTTATCGGCGACAAAGTGAATGACTGTGCCGGCAAGTTTTTGCTCAAGGTCGGCAATCTCAGCTT
TAGCCGCTTTCTCAGCTTTTTGCCCAACGGCGAGCATTTTCAGCCGCTGGTGCGTTTTGTCTCTTTCATT
CTTCGCGATCAGTTGGCTTGGGATCTGCGTCTTGGTTTTGCGGAAGGCGAAGCCAAGGGCTTAAGCCTGG
GAAGTGAACAAAGCAGCCGGTTGGGATGGAGCAGCTTTCTCGGGCAACCCCCAACGGATCCCTATGTGAC
GATTTGTGTGCAGGAGTAA