SecReT6
Protein ID: 50122365
SecReT6 ID40
T6SS typei1
Gene symbol-
Locus tagECA3442
StrainPectobacterium atrosepticum SCRI1043
Repliconchromosome [GenBank: NC_004547] [Browse all T6SS(s) in this replicon]
Location [Strand]3859750..3861516 [-]
Producthypothetical protein
NoteTssF
UniProt IDQ6D1K4
KEGG IDeca:ECA3442
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.80E-199, Aligned region: 3..587
Protein Sequence: 588 a.a.     [Download]
>gi|50122365|ref|YP_051532.1| unnamed protein product [Pectobacterium atrosepticum SCRI1043]
MSLEHFFRDELTYLRLQGREFAKAHPELTRFLSEQTTDPDVERLLEGFAFLTGSLRAKIEDEFPELTHGL
LGMLWPNYLRPVPSMTIMQFSVHPGAIAQPAFVARGCELDSLPIDDVVCHFQTCHDAWIYPADIREIKVQ
SGNDLSTITLDIGLHGPLSLSDLQLDKLRFYLGGDTYTAYELYFWIASQLSHIELEVDGQRFRQEASVLK
TVGFEREDALLPYPGNVYSGYRILQEYFCFPESFLFFQLAGAVWPDLPLTVTEFRLHFCFDRPLPAELKI
RPDSFMFNCVPAINLFQHDSEPINLSGRQTDYPLKASYRNADSFEIFSVDKVEGWVEGNSGRSRGIPRTY
QPFESFQHQIERAKGRLALYYRIRVREAINGNGFDHMLSFVRGDEQEVIDLDESISVTLTCTNRSRAAQL
SVGAICVPTGNSPSFATFRNLVRPTRPLRPAMDGSLHWTLISNLSLNYVSLLRRDALVQILRTYDFPALH
DKQAEQASRKRLAGIESIETTPIDRLVQGMPVRGLKSILSVRQSAFSSEGELYLFSTVLAHFFSLYASVN
AFHLLEVVNIDNKERYRWPVQIGQHSMM
 
Nucleotide Sequence: 1767 bp     [Download]
>gi|50118965|ref|NC_004547.2|:c3861516-3859750 Pectobacterium atrosepticum SCRI1043 chromosome, complete genome
ATGTCACTGGAACATTTTTTCAGGGATGAGCTGACCTACTTGCGCCTGCAAGGGCGTGAATTCGCCAAGG
CGCACCCTGAGCTTACCCGATTTTTGTCAGAACAAACTACGGATCCAGACGTCGAACGTCTGCTGGAAGG
GTTCGCCTTTTTGACAGGGAGCCTGCGGGCGAAGATCGAGGATGAATTTCCGGAACTGACACATGGTCTG
CTAGGCATGCTGTGGCCTAATTACCTGCGCCCCGTACCAAGCATGACAATTATGCAGTTTTCGGTACACC
CCGGTGCGATTGCCCAACCTGCGTTTGTGGCGCGAGGCTGTGAGCTTGATAGCCTGCCGATTGACGATGT
AGTTTGCCATTTTCAGACCTGCCACGATGCCTGGATTTATCCGGCAGATATCCGCGAGATCAAGGTACAA
AGCGGCAACGATCTTTCCACTATTACTCTGGATATTGGGCTGCATGGCCCGCTATCACTCAGCGATCTGC
AACTCGACAAACTGCGCTTTTATCTGGGCGGTGATACCTATACCGCCTACGAGCTCTATTTCTGGATCGC
TAGCCAACTGTCGCATATTGAGCTGGAAGTTGATGGCCAACGTTTCCGTCAGGAAGCTAGCGTGCTGAAG
ACGGTCGGCTTTGAGCGTGAAGATGCCCTGTTGCCGTATCCCGGCAATGTCTATTCGGGCTACCGCATTT
TGCAGGAATACTTTTGTTTTCCTGAAAGTTTTCTCTTTTTCCAACTTGCTGGCGCGGTATGGCCTGATCT
CCCGCTAACGGTAACGGAATTTCGTCTGCATTTTTGCTTTGATCGCCCGTTGCCAGCGGAACTGAAGATC
CGCCCTGATTCGTTCATGTTCAACTGCGTGCCTGCAATTAATCTCTTCCAGCATGATAGCGAACCGATCA
ACCTCAGCGGACGCCAGACCGATTACCCGCTGAAAGCCAGCTACCGTAACGCTGATAGCTTTGAAATTTT
CTCTGTGGATAAGGTTGAAGGCTGGGTTGAAGGGAATTCAGGTCGTTCTCGGGGAATTCCACGCACGTAT
CAGCCTTTTGAGAGCTTTCAGCACCAAATTGAGCGAGCCAAAGGACGGCTGGCGCTCTATTACCGCATCC
GGGTAAGAGAAGCCATCAATGGTAACGGTTTTGATCATATGCTCTCTTTTGTGCGCGGTGATGAGCAAGA
AGTGATTGATTTAGATGAATCCATCTCGGTAACCCTGACTTGCACCAATCGATCGCGTGCGGCGCAGCTG
TCCGTTGGGGCGATCTGCGTGCCAACCGGGAATTCACCGTCTTTCGCAACGTTTCGTAATTTGGTTCGCC
CGACGCGGCCGCTGCGGCCAGCGATGGATGGCAGCCTGCATTGGACGCTGATCTCCAACCTGTCCTTGAA
CTACGTGTCGTTGCTGCGGCGTGATGCGTTGGTACAGATTCTGCGTACCTACGATTTCCCCGCGCTGCAC
GATAAGCAGGCAGAGCAAGCCTCGCGTAAGCGTCTGGCGGGTATCGAGTCTATCGAAACCACCCCTATCG
ATCGTCTGGTTCAGGGCATGCCGGTGCGCGGCTTGAAATCAATCCTGTCGGTACGGCAATCCGCGTTTTC
CAGTGAAGGAGAACTCTATCTGTTTAGTACGGTGCTGGCGCACTTTTTCTCGCTATACGCCAGCGTTAAC
GCTTTCCACCTGTTGGAAGTGGTCAACATCGATAACAAGGAGCGCTACCGATGGCCGGTACAGATAGGTC
AACACTCAATGATGTGA