SecReT6
Protein ID: 50122366
SecReT6 ID40
T6SS typei1
Gene symbol-
Locus tagECA3443
StrainPectobacterium atrosepticum SCRI1043
Repliconchromosome [GenBank: NC_004547] [Browse all T6SS(s) in this replicon]
Location [Strand]3861519..3861950 [-]
Producthypothetical protein
NoteTssE
UniProt IDQ6D1K3
KEGG IDeca:ECA3443
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 2.20E-20, Aligned region: 32..123
Protein Sequence: 143 a.a.     [Download]
>gi|50122366|ref|YP_051533.1| unnamed protein product [Pectobacterium atrosepticum SCRI1043]
MPSLSAWERGSAASLFDRIRGEERRSSPETEVEALIESVKRQLDNVLNTRPGNCRSAPELGVIDFNDATQ
GGADIRGKIREAIRQCICRFEPRIVHVDVNTSDYLSNPMEMSFQVTARVRLEDLEQVASFNIHMDSHRHY
RMI
 
Nucleotide Sequence: 432 bp     [Download]
>gi|50118965|ref|NC_004547.2|:c3861950-3861519 Pectobacterium atrosepticum SCRI1043 chromosome, complete genome
ATGCCGTCTCTTTCTGCCTGGGAAAGGGGAAGCGCGGCAAGTCTGTTTGATCGTATCCGTGGGGAGGAAC
GTCGTTCCTCCCCTGAAACGGAAGTTGAAGCACTGATCGAGTCCGTTAAGCGTCAACTGGACAACGTGCT
CAACACCCGGCCCGGAAATTGCCGCAGCGCACCTGAGCTTGGCGTGATTGATTTTAATGACGCGACGCAG
GGTGGTGCGGATATTCGGGGGAAAATCCGGGAGGCGATCCGACAGTGTATCTGTCGCTTTGAACCTCGAA
TTGTTCATGTAGATGTCAACACGTCGGACTATTTATCGAATCCGATGGAGATGTCGTTTCAGGTTACCGC
CCGGGTCAGATTGGAAGATCTGGAGCAGGTCGCCTCTTTCAATATCCACATGGATAGCCACCGTCATTAC
AGAATGATCTGA