SecReT6
Protein ID: 50122367
SecReT6 ID40
T6SS typei1
Gene symbol-
Locus tagECA3444
StrainPectobacterium atrosepticum SCRI1043
Repliconchromosome [GenBank: NC_004547] [Browse all T6SS(s) in this replicon]
Location [Strand]3861956..3863434 [-]
Producthypothetical protein
NoteTssC
UniProt IDQ6D1K2
KEGG IDeca:ECA3444
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 6.70E-185, Aligned region: 65..490
Protein Sequence: 492 a.a.     [Download]
>gi|50122367|ref|YP_051534.1| unnamed protein product [Pectobacterium atrosepticum SCRI1043]
MSIVEEQAQAGAASTSGSLLDDIMAQARISPVDEGYSVAKQGIAALVANILDSGNAAEPVNKALVDSMIV
ELDKKLSKQIDVILHAKELQELESSWRSLKLLIDRTDFRENIKLLVLHATKEELLEDFEFAPEISQSGFY
KHVYSSGYGQFGGQPIGGVIGDYAMTQSSPDIKLMQYVSAVGAMAHAPFISSVAPTFFGVDRFTDLPSIK
DLKSVFEGPAYTKWRSLRESEDGRYLGLTAPRFLARLPYDPVENPIKGFNYKEDISTDHEHYLWGNTAYL
MGTALTDSFAKYRWCPNIIGPQSGGAITDLPVHVYQAMGQLQAKIPTEVLITDRREYEMAEEGFITLTMR
KDSDNAAFFSANSVQKPKVFPNTKEGKEAETNYKLGTQLPYMFIINRLAHYIKVLQREQIGSWKERQDLE
RELNTWIKQYIADQENPPADVRSRRPLRAAQIKVLDVEGEPGWYQVTMSVRPHFKYMGANFELSLVGRLD
KE
 
Nucleotide Sequence: 1479 bp     [Download]
>gi|50118965|ref|NC_004547.2|:c3863434-3861956 Pectobacterium atrosepticum SCRI1043 chromosome, complete genome
ATGTCAATAGTTGAAGAACAGGCCCAGGCAGGGGCTGCCAGCACCTCTGGCTCGCTGCTTGATGACATCA
TGGCTCAAGCGCGTATCAGCCCAGTCGATGAAGGCTATAGCGTGGCTAAACAGGGTATTGCCGCGCTGGT
TGCTAACATTCTTGATAGCGGTAATGCAGCAGAACCCGTGAATAAAGCGCTGGTCGATAGCATGATCGTC
GAACTGGACAAAAAGCTCAGCAAGCAGATTGACGTTATTCTGCATGCGAAAGAACTTCAGGAATTGGAAT
CTTCCTGGCGTTCTCTGAAACTGCTTATCGATCGCACCGATTTCCGTGAAAACATCAAACTGCTGGTGTT
GCATGCGACGAAAGAAGAACTGTTGGAAGATTTCGAGTTCGCTCCTGAAATCTCACAGTCTGGCTTCTAT
AAGCACGTTTATTCCAGCGGTTATGGCCAATTTGGTGGCCAGCCTATCGGTGGGGTGATTGGTGACTATG
CGATGACGCAAAGTTCGCCAGACATCAAACTGATGCAGTATGTCAGCGCCGTTGGCGCGATGGCACATGC
GCCGTTCATCTCTTCCGTTGCACCGACCTTCTTTGGCGTGGATCGTTTCACCGATCTGCCTTCCATCAAA
GATCTGAAATCCGTTTTCGAAGGCCCAGCCTACACGAAATGGCGTTCTCTGCGTGAATCTGAAGACGGCC
GCTATCTGGGGCTGACGGCACCGCGCTTTTTGGCTCGCCTGCCTTATGACCCGGTTGAAAACCCGATTAA
GGGCTTCAACTACAAAGAAGATATCAGCACCGATCACGAACACTATCTGTGGGGCAATACCGCCTATCTG
ATGGGAACGGCGCTGACGGACAGCTTCGCAAAATACCGCTGGTGTCCGAACATCATTGGCCCACAGAGCG
GTGGTGCGATTACCGACTTGCCGGTGCATGTTTATCAAGCCATGGGCCAACTTCAGGCCAAGATCCCGAC
TGAGGTCCTGATCACCGATCGTCGCGAATATGAAATGGCTGAAGAAGGCTTTATCACGCTGACGATGCGT
AAAGACAGTGACAATGCGGCGTTCTTCTCTGCTAACTCGGTGCAGAAGCCGAAGGTGTTCCCGAACACCA
AAGAAGGCAAAGAAGCGGAAACCAACTACAAGCTGGGTACGCAACTGCCTTACATGTTCATCATCAACCG
TCTGGCGCACTACATTAAAGTGCTTCAGCGTGAACAGATTGGCTCATGGAAAGAGCGTCAGGATCTTGAG
CGCGAGCTGAATACCTGGATTAAACAGTACATCGCCGATCAGGAGAACCCGCCGGCAGATGTCCGTAGCC
GTCGTCCTCTGCGTGCCGCACAAATCAAAGTGCTGGATGTAGAAGGGGAACCAGGTTGGTATCAGGTCAC
CATGTCTGTGCGCCCGCACTTCAAGTACATGGGGGCGAACTTTGAGCTGTCGCTGGTAGGGCGTTTGGAT
AAGGAATAA