SecReT6
Protein ID: 50122368
SecReT6 ID40
T6SS typei1
Gene symbol-
Locus tagECA3445
StrainPectobacterium atrosepticum SCRI1043
Repliconchromosome [GenBank: NC_004547] [Browse all T6SS(s) in this replicon]
Location [Strand]3863466..3863969 [-]
Producthypothetical protein
NoteTssB
UniProt IDQ6D1K1
KEGG IDeca:ECA3445
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.00E-56, Aligned region: 9..161
Protein Sequence: 167 a.a.     [Download]
>gi|50122368|ref|YP_051535.1| unnamed protein product [Pectobacterium atrosepticum SCRI1043]
MAKGTDGASVAPKERINIKYVPATGGQQAEIELPLTLMIVGNMKGRTEETPIEERQTVSIDKNNFTSVMK
EANLELNFSVPNRLEEESQDDLPVKLSIGGLNDFSPDRIAQQVPELRKLLDLREALVALKGPLGNIPSFR
NRLQDLLSSEEAREQLLKELELVKPAE
 
Nucleotide Sequence: 504 bp     [Download]
>gi|50118965|ref|NC_004547.2|:c3863969-3863466 Pectobacterium atrosepticum SCRI1043 chromosome, complete genome
ATGGCAAAAGGAACTGATGGTGCATCTGTCGCACCAAAGGAACGTATTAATATCAAATATGTTCCGGCCA
CTGGTGGTCAGCAGGCGGAAATAGAATTGCCGTTAACGCTGATGATCGTGGGAAATATGAAAGGGCGCAC
AGAGGAAACGCCGATCGAGGAACGTCAGACCGTATCGATCGATAAAAACAATTTTACCTCCGTGATGAAA
GAAGCAAATCTGGAACTGAATTTCAGTGTGCCAAATCGCCTTGAAGAAGAAAGTCAGGACGACCTGCCAG
TGAAATTGAGCATCGGCGGTTTGAATGATTTCTCCCCTGACCGCATTGCCCAGCAAGTGCCTGAATTACG
TAAGCTGCTTGATTTACGTGAGGCACTGGTCGCGCTGAAAGGCCCCCTCGGCAATATTCCCTCATTCCGT
AATCGTTTGCAGGATCTGTTGTCCAGCGAAGAAGCCAGAGAGCAGCTTTTAAAAGAGCTCGAGCTGGTGA
AACCCGCCGAATAA