SecReT6
Protein ID: 507480524
SecReT6 ID792
T6SS typei4b
Gene symboltssB
Locus tagtssB
StrainAcinetobacter baumannii M2
Repliconchromosome [GenBank: KC432605] [Browse all T6SS(s) in this replicon]
Location [Strand]2685..3188 [+]
Producthypothetical protein
NoteTssB
UniProt IDR9RIN9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.80E-58, Aligned region: 11..166
Protein Sequence: 167 a.a.     [Download]
>gi|507480524|ref|AGM48618.1| hypothetical protein [Acinetobacter baumannii]
MAKRESVQKKLQRIRPPRVQLTYDVEIGDAKEAKELPFVVGVMGDFSAASELERTKLKDKKFINVDLDNI
DEVMESLSPRAAFQVDNTLTEEGGKMAVDLTFKSMEDFRPENVVQQVDPLKKLVEARERLTDLRNKISNS
ERLEDLLDEVLKNTDQIRKLSAEADHE
 
Nucleotide Sequence: 504 bp     [Download]
>gi|507480521|gb|KC432605|tssB|:2685-3188
ATGGCTAAAAGAGAAAGCGTACAAAAGAAGCTTCAACGAATTCGACCTCCTCGTGTTCAGCTTACTTACG
ATGTTGAAATTGGTGATGCAAAAGAAGCGAAAGAACTCCCGTTTGTTGTTGGTGTGATGGGTGACTTTTC
TGCAGCATCTGAGCTTGAACGTACAAAGTTAAAAGATAAAAAATTTATTAACGTAGATTTAGATAATATC
GATGAAGTAATGGAGTCGTTATCTCCAAGAGCTGCTTTTCAGGTAGATAATACGCTAACTGAAGAGGGTG
GGAAGATGGCTGTTGATTTAACATTTAAGTCAATGGAAGATTTCCGTCCTGAAAATGTTGTTCAACAAGT
TGATCCATTAAAGAAATTAGTGGAAGCGCGTGAACGTTTAACTGATTTAAGAAATAAAATTTCTAACAGT
GAACGTTTAGAAGATTTGCTTGATGAGGTTCTTAAAAATACTGATCAGATTCGTAAATTAAGTGCGGAGG
CTGACCATGAATAA