SecReT6
Protein ID: 507480525
SecReT6 ID792
T6SS typei4b
Gene symboltssC
Locus tagtssC
StrainAcinetobacter baumannii M2
Repliconchromosome [GenBank: KC432605] [Browse all T6SS(s) in this replicon]
Location [Strand]3181..4662 [+]
Producthypothetical protein
NoteTssC
UniProt IDR9RFN4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 2.40E-191, Aligned region: 65..489
Protein Sequence: 493 a.a.     [Download]
>gi|507480525|ref|AGM48619.1| hypothetical protein [Acinetobacter baumannii]
MNNTQSAAMPLVENEEFNLLDSIVEQSRIARNEEEHSRAKSLIGELAKEVMAGTITVSENMTLSIDKRIA
EIDALISSQLSQIMHNEQFQKIESTWRGLYYFCQETPSNPLIKIRMLNTTKKELVKDFQGATDFDQSTLF
KKIYEEEYGSFGGAPYSALIGDFEFDRTPSDMYLLEQISHVAAAAHAPFVSAASPSILGLESFTDIDRPR
DVSKIFETAEYVQWRSFRDSEDSRYVALTLPHVLGRLPYHPKEGTATEGFNFIEDVSGENHNEYLWMNAA
YAFGTRLTNAFDMHGWCAAIRGVEGGGLVEGLPVHTFKTQDGEVVFKCPTEIAITDRREKELSDLGFIPL
VHCKNTDYAAFFGAQSTQKPKKYDNDTANANSALSSQIQYIMAVSRIAHYLKAMMRDKVGSFASAGNVEA
FLNEWLSQYVLLDDGASQEAKAQYPLREASVKVVEDPAQPGHYKSVVFLRPHFQLDELSVSLRLVTELPQ
SSN
 
Nucleotide Sequence: 1482 bp     [Download]
>gi|507480521|gb|KC432605|tssC|:3181-4662
ATGAATAATACTCAATCAGCAGCGATGCCACTTGTTGAAAATGAAGAATTTAATCTTTTAGATTCGATTG
TTGAACAAAGTCGCATTGCACGAAATGAAGAAGAACATTCACGTGCTAAAAGTTTAATTGGTGAACTTGC
CAAAGAAGTAATGGCTGGAACCATTACTGTTTCTGAAAATATGACTTTATCAATTGATAAGCGTATTGCA
GAAATCGATGCGCTGATTTCAAGTCAGTTAAGTCAGATTATGCACAATGAACAATTTCAAAAAATTGAAT
CAACGTGGCGTGGTCTTTATTACTTCTGCCAAGAAACACCTTCAAATCCGCTCATTAAAATTCGTATGTT
AAATACAACAAAGAAAGAGTTGGTAAAAGATTTTCAGGGTGCTACAGATTTTGATCAAAGCACTTTATTT
AAGAAAATCTATGAAGAAGAATATGGCTCTTTTGGTGGTGCACCATACTCAGCATTAATTGGTGATTTTG
AGTTTGACCGCACGCCATCTGACATGTATTTGCTTGAACAAATTTCTCATGTTGCTGCAGCAGCGCATGC
ACCATTTGTTTCGGCTGCTAGCCCAAGCATTTTAGGCCTTGAGTCATTTACAGATATTGATCGTCCTAGA
GATGTTTCAAAAATCTTTGAAACTGCTGAATATGTTCAATGGCGTTCTTTCCGTGACAGTGAAGATTCAC
GTTATGTTGCATTGACGTTGCCGCATGTTTTAGGTCGTCTCCCATATCATCCAAAAGAAGGCACTGCGAC
AGAAGGCTTTAATTTTATTGAAGATGTTTCTGGTGAAAATCACAATGAATATTTGTGGATGAATGCAGCT
TATGCTTTTGGTACTCGTTTAACAAATGCATTTGATATGCATGGTTGGTGTGCTGCTATTCGTGGTGTTG
AAGGTGGTGGTTTGGTTGAAGGTTTACCAGTCCATACATTTAAAACACAAGATGGTGAAGTAGTATTTAA
GTGTCCAACTGAAATTGCAATTACAGATCGTCGTGAGAAAGAGCTAAGCGATCTAGGCTTTATTCCATTA
GTACATTGTAAAAATACAGATTACGCAGCTTTCTTTGGTGCGCAATCAACTCAAAAACCTAAAAAATATG
ACAACGATACTGCCAACGCAAACTCGGCTTTATCAAGTCAAATTCAGTACATCATGGCTGTTTCACGTAT
TGCACATTACTTAAAAGCAATGATGCGAGATAAAGTGGGTAGTTTTGCTTCTGCTGGTAATGTTGAAGCA
TTTTTAAACGAGTGGTTGTCACAGTATGTATTACTTGATGATGGCGCTTCTCAAGAAGCAAAAGCTCAAT
ACCCATTACGTGAAGCGTCTGTAAAAGTTGTAGAAGATCCTGCTCAACCAGGTCACTACAAATCTGTGGT
TTTCTTGCGACCACATTTCCAGCTGGATGAGTTGTCGGTTTCTTTACGACTTGTCACTGAGTTGCCTCAG
TCCTCAAATTAA